KEGG   Acidobacterium capsulatum: ACP_3506Help
Entry
ACP_3506          CDS       T00868                                 

Definition
(GenBank) putative DNA ligase, ATP-dependent
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
aca  Acidobacterium capsulatum
Pathway
aca03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:aca00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    ACP_3506
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:aca03400]
    ACP_3506
Enzymes [BR:aca01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     ACP_3506
DNA repair and recombination proteins [BR:aca03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     ACP_3506
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_C DNA_ligase_A_M DUF4604
Motif
Other DBs
NCBI-ProteinID: ACO34127
UniProt: C1F736
LinkDB All DBs
Position
4075693..4078284
Genome map
AA seq 863 aa AA seqDB search
MRDFGVTPEPKGAAGKRLNAGALSFVVQKHAASHLHYDFRLEWQGVLKSWAVAKGPSYYP
GDKRLAVEVEDHPLAYGGFEGIIPQGQYGGGTVMLWDRGTWEPLGDAARQLRDGNLKFRL
HGEKLKGCWALVRMKGKFAGRSKPSWLLIKEHDESERGDDAPAIVDEAPLSVVSGRDMQQ
IAEAQDAVWNAKGAQAQSSAAAHRANAPKQSMPAALLPREIAATLKRLPSEALPRFVPPQ
LATLVSEPGAGENRVYEIKLDGYRIEARVDKKADPPVQLLTRTGLDWTSRMRPLADALLR
LPVQTALLDGELVVLEEKGTTSFAKLQAVLKDDSRHSLTYFAFDLLHLDGHNLRGEPLLI
RKKILSALLTDLPASSAVRFSEHVKGNGEEIFQKACKLGAEGVISKLAQGFYHSGRSRDW
WKLKCYLEQELVIGGYTLPSNGTYGVGALLLGYYDAGKLIYAGRTGTGFTRATHRRMREQ
LEAIRRGTAPFAKVEQDARRGAIWVQPQLVAQVSFASWTTDGLVRQAAFKGLREDKPAKT
VRREGGQMPESEGKAAKKPRANSTTVRSELRLTHRDKVLDKDSGLTKEALADYYARIAPF
MLPHIQGRAVSIVRCPAGSDLSCFFQKHNNHTLPGEIESIEIASRKTGKVEPFLTISSAN
DLLVLAQASVLEIHAWGSTRDSLEKPDRLTIDLDPDDAIDWKTLAGAAVEVRKRLARAGV
KSFLKSTGGKGLHVVAPIEPEHEWPEVKEFAHRMVLEMEKENPDLYLTRMTKAARKGKIY
LDYLRNERGATAIAPFSPRARPGAPVALPLRWSELKSAERPIFRVTEFDGWRKRLKADPW
RGFLQLHQSLRLPEAARVSPGGR
NT seq 2592 nt NT seq  +upstreamnt  +downstreamnt
atgagagattttggcgtgacgcccgagccaaagggcgcggcggggaagcgtttgaacgcg
ggcgcgttgagctttgtggtgcaaaagcatgcggccagtcatctgcattacgacttccgc
ctggagtggcagggagtgctcaagagctgggcggttgcgaaggggccaagttattatccc
ggcgacaagcggctcgccgtcgaggtcgaagaccatccgttagcctatggtggattcgag
ggcatcattcctcagggccagtacggcggcggcaccgtgatgctgtgggatcgcggcacc
tgggagccactgggtgatgcggcccgccagttgcgcgatggcaatctgaagtttcgattg
catggcgagaagctgaaaggctgctgggcgctggtgcgcatgaaagggaagtttgcgggg
cgatcgaagccgtcatggttgctgatcaaggagcacgacgaatccgaacgcggcgacgat
gcgccggccattgtggacgaagctccgctcagcgtagtgagtggccgggacatgcagcag
atcgccgaggctcaggatgccgtgtggaatgcgaagggcgcgcaggcgcaaagctccgcc
gctgcgcatcgtgccaatgccccgaagcaatccatgcccgccgcactccttccgcgcgaa
atagcggctactctcaagcgcttgcccagcgaggcgttgccgcggtttgtgcctccacaa
cttgcgacgctcgtgagcgagccgggggctggtgagaatcgcgtctacgaaatcaagctc
gatggctatcgcatcgaggcgcgcgtggacaagaaggccgatccgccggtgcagcttctc
acgcgcacgggccttgactggacgagccggatgcggccgttggccgatgctctgctgcgg
ctgccggtgcagaccgccttgctcgacggcgaactggtggtgctcgaagagaagggaacg
accagcttcgccaaattacaggcagtactgaaggatgactcccggcattcactcacatac
tttgcctttgacctgctgcatctggatgggcataatctgcgcggcgaaccattgctcatt
cgtaagaagatactcagcgcactgttgactgatttgcccgcaagcagcgcggtgcgcttc
agcgagcacgtgaaaggcaatggcgaggagatatttcaaaaggcctgcaaactcggcgcg
gaaggggtcatttcaaagctcgcgcagggcttttaccactccggccggagccgcgactgg
tggaagctcaagtgctatctcgaacaggaactggtcatcggcggatacacgctcccttcc
aacggcacctatggggtgggcgcattgctgctgggctattacgacgccggcaagctgatc
tacgcgggccgcacgggaacaggtttcacgcgcgccacgcatcgccgcatgcgagagcag
ttggaggccattcgccggggaactgcgccatttgcaaaggtggagcaggatgcgcggcgc
ggggccatctgggtgcagccgcagctcgtggcccaggtttcattcgcaagctggacgacc
gatggtctcgtccggcaggctgccttcaaggggttgcgtgaagacaagccggcaaagact
gtgcggcgcgaagggggacagatgccagaatcggaaggaaaggcggcgaagaaacctcgc
gcgaacagcaccacggtgcggtcagagcttcggctcacccatcgcgacaaagtgctcgac
aaggattcgggcctgaccaaagaggcgctcgcggactattacgccaggatcgcgcccttc
atgctgccgcacattcaagggcgtgcggtgtcgattgtgcgctgtcctgcgggcagtgac
ctgagttgcttctttcagaagcacaacaaccacacgctgcccggcgagatcgaaagcatt
gagattgcgagccgcaaaaccggcaaggttgagcccttcctcaccatctcaagcgcaaac
gatttgctggtactcgcgcaagccagcgtgcttgagattcatgcctggggttcgacgcgc
gactctctggaaaagccggaccgtctgacgatcgaccttgaccctgacgatgccatcgac
tggaagacgctggccggcgcggctgtggaggtgcgcaagcggctcgcacgcgcgggggtg
aaatcattcctcaagagcaccggcggcaagggccttcatgtcgtggcccccatcgagccc
gaacatgagtggcccgaggtcaaagagtttgcccatcgcatggtgctggagatggagaag
gaaaatcctgacctctatctcacgcgaatgaccaaggccgcccgcaaaggcaaaatctac
ctggattatctccgcaacgaacggggcgcgacggccatcgcgccgttctctccgcgagcg
cgcccgggagcgcccgtagcgctgccgctgcgctggtctgagctcaagtcggcggagcgg
cccatctttcgcgtgacggaatttgacggctggcgtaagaggctcaaggctgatccatgg
cgcggctttctgcagctgcatcagagtttgcgtctgcctgaggccgcccgggtgagtcca
ggaggaagatag

DBGET integrated database retrieval system