KEGG   Actinoalloteichus fjordicus: UA74_12725Help
Entry
UA74_12725        CDS       T04639                                 

Definition
(GenBank) small subunit of phenylpropionate dioxygenase
  KO
K16320  anthranilate 1,2-dioxygenase small subunit [EC:1.14.12.1]
Organism
acad  Actinoalloteichus fjordicus
Pathway
acad00627  Aminobenzoate degradation
acad01100  Metabolic pathways
acad01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:acad00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    UA74_12725
Enzymes [BR:acad01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.1  anthranilate 1,2-dioxygenase (deaminating, decarboxylating)
     UA74_12725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ring_hydroxyl_B SnoaL_4
Motif
Other DBs
NCBI-ProteinID: APU14603
LinkDB All DBs
Position
2869626..2870147
Genome map
AA seq 173 aa AA seqDB search
MTETTETALSRDVGQSTSMELWFRVLRLYTDYTELLDEKRLTEWLGLFEDDCRYLAISRE
NADAGLPLAMMRCEGVPGLSDRVNAIENVSVYAPRSMRHLVSGLRVSHTDEPGLLAVEAS
FVVLQSLNEEHTEVYASGRYRDLVRDDGGTLRFAEKTAVYDGALIKNAMVYPL
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagaccaccgagaccgcactcagccgcgacgtcgggcagtccacgtcgatggag
ctgtggttccgggtcctgcggctctacaccgactacacggagctgctcgacgagaagcgg
ctgaccgagtggctcggcctgttcgaggacgactgtcgatatctggcgatctcacgggag
aacgccgatgcgggactgcccttggcgatgatgcgctgcgagggcgttccggggctctcc
gaccgtgtcaacgccatcgagaacgtctcggtctacgcgccgaggtcgatgcgtcatctc
gtctcggggctccgggtgagccacaccgacgagccgggcctgttggcggtggaggcgtcc
ttcgtcgtgctgcagagcctcaatgaggagcacaccgaggtctacgcctcggggcgctac
cgtgacctggtgcgcgacgacggtgggacccttcgcttcgccgagaagacggccgtctac
gacggtgcgctgatcaagaacgccatggtctatccgctgtga

DBGET integrated database retrieval system