KEGG   Actinoalloteichus sp. ADI127-7: UA74_14300Help
Entry
UA74_14300        CDS       T04639                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
acad  Actinoalloteichus sp. ADI127-7
Pathway
acad00250  Alanine, aspartate and glutamate metabolism
acad00410  beta-Alanine metabolism
acad00430  Taurine and hypotaurine metabolism
acad00650  Butanoate metabolism
acad01100  Metabolic pathways
acad01110  Biosynthesis of secondary metabolites
acad01120  Microbial metabolism in diverse environments
acad02024  Quorum sensing
Module
acad_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:acad00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    UA74_14300
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    UA74_14300
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    UA74_14300
   00430 Taurine and hypotaurine metabolism
    UA74_14300
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    UA74_14300
Enzymes [BR:acad01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     UA74_14300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: APU14918
LinkDB All DBs
Position
3246889..3248265
Genome map
AA seq 458 aa AA seqDB search
MVLHSGRRQGPTPQGAGNPFYGLADPAPGSEITLPHQRLGAGPVPPDAVLQLVRDELELD
GSARLNLATFVTTWMEPQARELMNDCVAKNMIDKDEYPQTAELERRCVNILADLWHAPEP
ADVIGCSTTGSSEACMLAGMAFKRRWRGPGRPNLVMGANVQICWEKFCQYWEVEPRLVPM
AGDRFHLSADEAVARCDENTIGVVAILGSTFDGSYEPVAEITAALDGLQRRTGLDIPVHV
DGASGAMIAPFLDPGLTWDFRLPRVASINTSGHKYGLVYPGVGWVLWRHRDRLPAELVFK
VNYLGGEMPTFALNFSRPGAEVVAQYYTFARLGREGFRAVQQAARDVATRLADQIAELGP
FRLLTRGDELPVFAFTTNERAAGFTVFDVSRRLRERGWQVPAYTFPADREDLAVLRIVCR
NGFTQDLGDLFVEELRRVLADLDSSPGCGHATETAFHH
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggtgctgcattcgggccgccgccaggggccgaccccccagggagcaggcaatccgttc
tacggcctggccgaccccgcgccgggctcggagatcacgctgccccatcagcggctgggg
gcggggcccgtcccacccgacgccgtgcttcagctcgtgcgcgacgagttggaactcgac
ggcagtgcccgactcaatctcgcgaccttcgtgaccacctggatggagccgcaggcccgc
gagctgatgaacgactgcgtggccaagaacatgatcgacaaggacgagtatccgcagacc
gccgagctggagcgtcgctgcgtgaacatcctcgccgacctgtggcacgcgcccgaaccc
gccgatgtcatcggctgctcgaccaccggctcctccgaggcctgcatgctcgcgggcatg
gcgttcaagcgtcggtggcgcggaccgggcaggcccaacctcgtgatgggcgcgaacgtg
cagatttgttgggagaagttctgccagtactgggaggtggagccccggctcgtgccgatg
gcgggggaccggttccacctcagcgccgacgaggccgtcgcgcggtgcgacgagaacacc
atcggcgtcgtcgcgatcctgggctccaccttcgacggcagttacgagcccgtcgccgag
atcaccgccgcgctcgacggacttcagcggcgcaccggtctcgacatcccggtgcacgtg
gacggcgcctccggcgccatgatcgccccgttcctcgatcccggactgacctgggacttc
cgcctgccgagagtggcgtcgatcaacacctccggccacaagtacgggctggtctatccc
ggtgtgggctgggtgttgtggcggcatcgggaccggctgcctgccgaactggtgttcaag
gtcaactatctcggcggagagatgccgaccttcgcgctcaatttctcccggcccggcgcc
gaggtggtggcgcagtactacaccttcgcccggctgggcagggagggcttccgcgcggtg
caacaggccgccagggacgtggccactcgactggcggaccagatcgcggagctcgggcct
ttccggctgctcaccaggggcgacgaactgccggtgttcgccttcaccacgaatgagcgc
gccgcaggcttcaccgtcttcgatgtctcgcgtcggctgcgagaacgcggctggcaggtc
cccgcctacaccttcccggccgatcgggaggacctggcggtcctgcggatcgtctgccgc
aacggcttcacccaggacctcggcgacctgttcgtcgaggaactgcgtcgagtactcgcc
gatctcgactcctcgcccggttgcgggcatgccacggagaccgccttccaccactga

DBGET integrated database retrieval system