KEGG   Actinoalloteichus fjordicus: UA74_17285
Entry
UA74_17285        CDS       T04639                                 

Definition
(GenBank) Erythromycin biosynthesis sensory transduction protein eryC1
  KO
K13310  dTDP-3-amino-3,4,6-trideoxy-alpha-D-glucose transaminase [EC:2.6.1.106]
Organism
acad  Actinoalloteichus fjordicus
Pathway
acad00523  Polyketide sugar unit biosynthesis
acad01100  Metabolic pathways
acad01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:acad00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    UA74_17285
Enzymes [BR:acad01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.106  dTDP-3-amino-3,4,6-trideoxy-alpha-D-glucose transaminase
     UA74_17285
SSDB
Motif
Pfam: DegT_DnrJ_EryC1 Aminotran_1_2 Beta_elim_lyase Aminotran_5 Cys_Met_Meta_PP
Other DBs
NCBI-ProteinID: APU15487
LinkDB
Position
complement(3996772..3997980)
AA seq 402 aa
MTVPFLDPGAAYVELQDDIDAAVHRVLASGRYLLGPEIEAFESEYAAYCGARHCVAVGSG
CDALELALRAMDVGQGHEVLVPAHTFIATWLAVSATGAVPVAVEPDERTYNLDPDRLEDA
ITPRTRAIIPVHLYGQPADMDAVLAVARRHDLHVLEDAAQAHGARHRGVRVGSGSTATAF
SFYPGKNLGAMGDGGAVITGDDAVADRLRLLRNYGSTVKYRHEIKGTNSRLDEVQAAVLR
VKLTHLDAWNSRRADVAQRYLTECGDLPGVTMPYVMPWADPVWHLFVVRSARRDRLAQQL
DAAGIGTLIHYPTPVHLSPAYAGPRWPAGTFPRAERLSDQVLSLPIGPHLSEEDVTTVIA
ALRAAAGEQTDDARLHRGLAEDRDVRPPADAGGVGERPSAPA
NT seq 1209 nt   +upstreamnt  +downstreamnt
atgacggtaccgttcctcgatccgggcgcggcctatgtcgaactccaggacgacatcgat
gccgccgtgcatcgagtgctggcctccggccgatatctgctcgggcctgagatcgaggcg
ttcgagtccgagtacgccgcctactgtggagcccggcactgcgtggccgtcggcagcgga
tgcgatgcgttggaactggccctgcgcgccatggacgtcgggcaggggcacgaggtcctc
gtgcccgcgcacaccttcatcgccacctggctcgccgtctccgcgaccggcgccgtgccg
gtggccgtcgaacccgacgagcgcacctacaacctcgaccccgatcgcctcgaagacgcg
atcacgccgaggacgagggcgatcatcccggtgcacctgtacgggcagcctgcggacatg
gacgccgttctggccgttgcccggcgacacgacctgcacgtcctggaagacgcggcgcag
gcccacggcgcgcggcaccggggcgtgcgggtcggatcgggttccacggcgacggcgttc
agcttctatcccggcaagaacctcggtgcgatgggcgacggcggcgcggtgatcaccgga
gacgacgcggtggccgatcgcctgcggctgctgcgcaactacggctccaccgtgaagtac
cgccacgagatcaagggcaccaactcgcggctggacgaggtccaggccgccgtgctccgg
gtgaagctgacgcatctcgacgcctggaactcccggcgtgccgacgtcgcgcagcgctat
ctgaccgagtgcggtgatctgcccggggtgaccatgccctacgtcatgccgtgggccgac
ccggtctggcacctcttcgtcgtgcgcagtgcgcgtcgggatcggcttgcgcagcagctc
gacgccgccgggatcgggacgctcatccactatccgacgcccgtgcacctgtcgcccgcc
tatgccggaccacggtggcccgcaggcacgttcccgcgtgccgagcggctttccgaccag
gtgttgagcctcccgatcgggccgcatctgtccgaagaggacgtcaccaccgtcatcgcc
gctctccgtgccgcggccggtgagcagaccgacgatgcccgtctgcaccggggcctggcc
gaggacagggacgttcgtccgcccgccgacgccggaggtgtgggcgagcgtccgtctgca
ccggcctga

DBGET integrated database retrieval system