KEGG   Actinoalloteichus sp. ADI127-7: UA74_17320Help
Entry
UA74_17320        CDS       T04639                                 

Definition
(GenBank) polyketide synthase family protein
Organism
acad  Actinoalloteichus sp. ADI127-7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl_transf_1 ketoacyl-synt KR Ketoacyl-synt_C PS-DH PP-binding KAsynt_C_assoc adh_short Thiolase_N Epimerase GDP_Man_Dehyd Polysacc_synt_2 PKS_DE 3Beta_HSD RmlD_sub_bind Sacchrp_dh_NADP ACP_syn_III NmrA
Motif
Other DBs
NCBI-ProteinID: APU15494
LinkDB All DBs
Position
complement(4030264..4046739)
Genome map
AA seq 5491 aa AA seqDB search
MVRSSGVDRLPWILSGGGVQSVRGQAGRLLAHLDSTPDWHPVDVGWTLAQRRPAGGWRAA
LVAGERTDFLTGLRGLAAGHSAAGLVEGPHVGDSVAFVFSGQGSQWPGMARALLETSAVF
RARIDDCAQALEPFLDWSLLDLLRGASPELLLDRADIAQPALFAVGLAQASVWRAHGVEP
SAVAGHSLGEVLAAELSGALGLDDAARVAARWSQAQVTLAGRGEMVSVRATRAEVTEFLR
PWGDALGVAAVNGPAAVIVSGDADAADELVTALHADGRTARKVAVGLAAHSAHIDLIMPR
LRRELAPLRPVAPQLPFYSALHGSRLPDGELLDADYWCRNLRNTVRFDDVTRAVLADGHH
VLLEMSPHPVLTAAMLETVEDAGAAASVRGALRRDQADLARVTHSLAELHVDGVEFDASV
VFAGHGAALDLPAADEDGPVAEFVPLAEALAPRSAVEQLAALQELVCHEVAVTLGRTDGR
LVDPRRPFRDLGFDSVTAVEIRNRVGAATGLRLPHTLAFDYPTPARLAEFLHAELFGAAE
VDAVVPVPAAAEDPVVIVGLACRYPGGVASPEELWRVVAEGVDVVSGFPADRGWDVTGAY
SPVIDKPGQYYQSEAGFLPDADLFDAEFFGISPREALAMDPQQRLLLETSWEVLERTGID
PLSLRGSRTGVFVGAMTMDYGPRLDAASGHEGHVLTGNTGSVLSGRIAYTLGLEGPAVTV
DTACSSSLVALHLAAQAVRAGECTSALAGGVTVLPNLGMFVEFSRHGGLAPDGRCKPFSS
TADGFGLAEGVGLVLVERLSDARRLGHSVLAVVRGSAVNQDGASNGLTAPNGPSQQRVIR
QALASAGLSAADVDVVEAHGTGTRLGDPIEAQAVIATYGQGRSRPVLLGSVKSNLGHTQA
AAGIAGVLKMVLAMRHGIVPATLHLDEPSPQVDWSAGAVSLVPEAVEWASAGVRRAGVSS
FGISGTNAHVILEEPPSVPGRSPVPVSSDPGDRLGGRPAADAASPDSAVVPDESETAASG
RAEVTSWVLTAKSESALRAQAERLLEFVRRPDVDPADVAHSLVTTRSAFDYRAVVIGRDR
AELIDGLAAVAAARSSTFAVTGSAAVSGRLAVLFTGQGAQRAGMGSELYASHPAFAAAFD
EVCAELDPKLDRPLREVVFAEDHELLAQTGWTQAALFAVEVALFRLVESWGVRPDVVGGH
SIGEIVAAHVAGVLTLADACTLVAARGSLMQALPAGGAMASVRASEEEVRPLLTSGVSIA
AINGPHSVVVSGVEDEVAALATHFEKSRRLRVSHAFHSPLMDPMLAEFAEVVRGLEFHAP
RLVVLSNVTGGPADAEELRDGEYWVRHVREPVRFADGVRGLEDAGVSALLELGPGGVLSA
MAAESLRGSAVAVPSLLTDRPESLALRTAAARLFTLGVPIERDTLGTAGSRITLPTYVFD
RTRFWLEPRITSGSGADVEFWAAVGRGDLDALARSLDLGADERAPLAELLPWLSSWWERR
QRRSLVDGLRHEVVWRPTTPSAAAWLSGDWALISEDAADDLAAALSAAGAAVVRLTPTAL
AEGLPADCAGVVSTVGLHATLSMIQTLGDRTIPLWCVTRNGVAAAGSDGPVDPWQAAVWG
LGRVAALESPRLWAGLIDLPARPDAATLTRFTAVLADPAGEDQVAVRQSGTFVRRLARAR
SGASGGWRPSGTVLVTGGTGALGGAVARLLASGGADRLILTSRRGADAPGAADLAAELRA
LGADVDVVACDVADRAAVAALLAAHPVDAVFHTAGVLEDGVLASLTPEQLDRTLAPKAWG
ATHLDELTRDRELSAFVLFSSVTGVLGTAGQGNYAAANAFLDALAERRRAEGLPATAISW
GPWAGEGMAAGPVGTRLAEDGLRALPVPTALAALQLSLDRGETGVTVADVDWARFAPQFT
AARWSPLLADLPEVGARTDDRSPSTELAALDDAERGRVLLELVRTESAAVLGHRSGADID
AHRVFKDLGFDSLTAVALRNRMSAATGVLLSAAVVFDHPTPAALAAYLSQETTGGRREDA
PVAPVTAAVADDPIVIVGTACRFPGGVRSPEDLWRLLSHGEDAIGGFPSDRGWDLDALYD
PTAARSGTSYTRAGGFLPDAAEFDAAFFGISPREALAMDPQQRLLLETAWELFEHAGIRP
AAVRGERIGVFVGTNGQDYVTDLGDIPRDVEGQVLTGNAASVVSGRIAYTFGLEGPAVTV
DTACSSSLVALHLAVQALRSGECTAAVAGGVTVMSRPGVFVEFSRQRGLSADGRCRSFSA
SADGTGWSEGVGLVLVERLSDARRLGHSVLAVVRGSAVNQDGASNGLTAPNGPSQQRVIR
QALASAGLSTGDVDVVEAHGTGTRLGDPIEAHALLTTYGQGRSRPLLLGSVKSNLGHTQA
AAGIAGVLKMVLAMQHGVVPETLHVDEPTPQVDWSVGAVELAAESVPWPDTGRPRRAGVS
SFGVSGTNAHVILEAAPAPEPAADQPEPPPAAIEFTAEPATSPVVPWVLSGKSDAALRGQ
AARLAEFLRDRPDLPPTDVGAALASRSLFDRRVLLAGANRADLLASLDEVAAGRLTAGRR
AAGGVVLVFPGQGSQWVGLAVELLASSSVFAERMGECAAALSEFVEWSLFDVLSDEAALS
RVDIVQPVLFAVMVSLAELWRSVGVVPSAVVGHSQGEIAAACVAGGLSLRDAARVVARRS
RLIAALGGGGGMVSVALPLPEVADLLSGSVTVAAVNGPSSVVVSGARAGLTRVVAECESR
GVRARWIPVDYASHSVLIEEIRDQLLELLSEIEPRSSAVPFYSSVTGTVVDTASLDARYW
FRNLRETVRFDRAVAALLTDGLGVFVESSAHPVLTYGIQEVVDERDGDRDAADALVVGTL
RRADGGMDRFLASAGELFAHGVDVDVTPLLTGGRRVDLPAYAFQRDRFWLATPASAGDVA
SVGLDAADHPLLGATVPVAGSDEVVCTGRISVTEQPWLADHVVDGAVIFPGTGLVELATK
AGAAVGCTRLHELTLQTPLVVPESGAVRIQVVVGPQADDGARQVGVHARGTDDDAVHWTR
HATGLLLPTLPQADFDLTQWPPTGAETVDVDHVYGRFAQIGMLYGPAFQGLRRAWRRADE
IFVEVALAEEEGAAAQWFGVHPALLDAALHSFALDGSGPQEPLLPFVWSDVRSYAAGATE
LRVRVRRLAADTMSIQAADASGAPVLSAESLVVRPATRVRAGSSNRDSLFRVEWVPTEAA
GRRTAVSVLDHQERESTPRTAVGRVLTELQSWLAREPEERLVVLTRGAVAVTPEESPDLA
GAAVWGLVRSAQSEHPGRIVLVDTDGTVDLELLAALDEPQLAVRGDRVFAARLRRMSAVA
EPAWDASGTTLITGGTGTLGAAVARHLVTRHGVRDLVLTSRRGLTAPDAVELRDELVGLG
AAVVVVACDVADREQVAGLLAEHPVDAVVHTAGVLDDGVVTSLTPERLDTVFAPKADAAW
HLHELAGELSAFVSFSSAAGLIGNAGQGNYAAANAFLDALAHHRRARGLPAQSLAWGLWS
QASELTGALDGADVTRLGRAGVVPMSTEDGLARFDAALGVDEASVVPLRLDLTAFQGEVP
RLFADLVPARRRAVAAAGTLRERIADLDDPRQKSLLGDLVRAQAARVLGHSSPEAVDTAQ
TFQLLGFDSLTAVELRNRLNVETGLRLPATMVFDYPTPGALADFLHQRLFGQTVATAEPL
AVEPGTTGSVSDDPIVIVGMACRFPGGVNDPDSLWRLLADGGEVVSDFPTDRGWNLHELY
DPEPGVPGKSYTRAGGFLRDVADFDAGFFEISPREALAMDPQQRLLLETSWEVFERAGID
PVSMRGSRTSVYAGLMYHDYAARLPRVPEDVEGYAGNGNAGSVASGRVAYALGLEGPAVT
VDTACSSSLVALHLAAQALRSGECDLALAGGVTALATPGVFVEFSRQRGLSADGRCKSFA
GAADGTGWSEGVGLVLVERLSDARRNGHSVLAVVRGSAVNQDGASNGLTAPNGPAQQRVI
RQALASAGVSAADVDVVEAHGTGTRLGDPIEAQALIATYGQDRARPLLLGSVKSNLGHTQ
AAAGIAGVMKMVLAMRHGVVPKTLHVDEPTPHVDWSAGAVELVTEAQPWPVADRPRRAGV
SSFGVSGTNAHVIVEAPPEPPADPVASAAAAPDHSIVPWILSGKSDAALRAQADRLVDFL
RARPAVRPADVGMSLATARARFDRRVLISGSRTDEFMAGLSAVASGAVVPGGRVAGGVVL
VFPGQGSQWVGMAAGLLGSSPVFAGRMGECAAALSEFVGWSLFDVLGDEQALGRVDVVQP
VLFAVMVSLAELWCSVGVVPSAVVGHSQGEIAAAVVSGGLSLRDGVRVVVQRSRLIAGLG
GGGGMVSVALPASEVTELLPDGVSLAAVNGPSSVVVSGSVSGLERVVADCESRGVRARWV
PVDYASHSVLMDALRDELVESLADVEPRSSEIPFYSSVTGAPSDTASLDAGYWFRNLRET
VRFDRAVESLLVGGFGVFVESSAHPVTTYGIQEVIDERDGDALAIGTLRRDDGGMDRFLA
SAGELFTHGVDVDVTPLLAGGRQVDLPTYAFQRERYWLQTPKGFAGDLASIGQQDAGHPL
VGASVSMADSDGVVLTGQVSIETHPWLAEHAVAGTVLLPGTAFVELAVHAGDQVGCSRVA
ELTLAAPVILPPHGGVAVQVLVGAPDESGLRPVSVYSRRADAENDAWTCHAFGQLGVDQP
SRDLGLTAWPPAATVVPLAGVYERLYDQGYQYGPMFQGLRAMWRTEEEIYAEVMLPAEAT
TGATAFGLHPALLDAALHPAGAVAQTEEVRLPFSWSGVSIHAAGARVLRVRLTMRGEGVV
SLDAADQTGAPVVSVDSLALRPVTPDQLAVASTDSLYHLDWTGPQALATVGGTSVAWIGR
DLDLDSQAADGSTPAVVLLDAACAGSQDAPTRARRVVGAVLDVVRAWLADQRFADTRLAV
VTRGAVRAVDGDVPDPASAAVWGLVRSAQSENPDRLILLDAEEHTGDAELSAAAACGEQQ
IAVRAGQLFIPQLARSRTTESAAPSWDPAGVVLITGGTGTLGAAVARHLVRRHGVRNLVL
ASRRGLDAPGAVALREELTGWDAEVAVVACDLSDRAAVAALLAAHPITTVVHSAGALDDG
VVSALTPERVDTVFRPKVDAAWHLHELAGDLSAFVMFSSASGVFGTAGQSNYAAANTFLD
ALAEHRRAHGLPAHSLAWGWWESTSEMTARLGAADRSRMTRRGVVPLSTDEGLALFDTAV
AGPRPVVLPVRLDLRATLPAVCRALQRTTRRTAAAPAAGEATLVDRLVRLDPPDRAAALL
TLVRSAGAEVLGHATVGEVRPTRAFKELGFDSLMAVELRNRLHRETGLRLPATLVFDYPT
PQAIVGLLDVELFGAAVPESPASPVLADLDRLEAGLTGDLDDETRSAVTDRLKALLTRWT
GDAAHGSFADQLDSASDDEIFTLIDNRLGRS
NT seq 16476 nt NT seq  +upstreamnt  +downstreamnt
atggtgcgtagttccggggtggatcggctgccgtggatcttgtccggcggcggcgtgcag
tcggtacgcggccaggcaggccgactgctcgcccacctggactcgacgccggactggcac
ccggtcgacgtcggctggaccctcgcccagcgtcgtcccgcaggcgggtggcgggccgca
ctcgtcgcaggcgagcgcaccgacttcctgaccggtctgcgcgggctggctgcaggacac
agcgccgccggtctggtggagggaccccacgtcggggactccgtggccttcgtcttctcg
ggacagggctcgcagtggccgggcatggcccgcgcactgctggagacctccgccgtgttc
cgcgcccggatcgacgactgcgcgcaggcactggagccgttcctggactggtccctgctc
gatctgctgcgcggggcgtcgccggagctgttgttggaccgcgccgacatcgcgcagccc
gcgctgttcgcggtcggcctggctcaggcctcggtgtggcgcgcacacggcgtggagccc
tcggccgtcgcggggcacagtctgggcgaggtcctcgcggccgagttgtccggtgcgctg
ggcctcgacgacgcggcccgagtcgcggcccggtggagccaggcgcaggtgacgctggcg
ggccgaggcgagatggtgtcggtccgcgcgacccgagcggaggtgacggagttcctacgg
ccctggggcgacgcgctcggcgtcgccgcggtgaacggacccgccgcagtgatcgtctcg
ggggacgccgacgccgccgacgagctcgtgaccgccctgcacgccgacggcaggaccgcg
cgcaaggtcgccgtcggactcgcggcgcactccgcccacatcgacctgatcatgccccgc
ctgcgccgggagctggccccgctgcggccggtggcgccgcagctgcccttctactcggcg
ctgcacggatctcggctgcccgacggtgagctgctcgatgccgactactggtgccgcaat
ctccgcaacaccgtgcggttcgacgacgtgaccagggcggtgctcgccgacggccaccac
gtgttgctggagatgagcccgcatccggtgctgactgcggcgatgctggaaaccgtcgag
gacgccggggctgcggcgtcggtgcgcggggcgctgcgccgcgatcaggccgatctcgcg
cgcgtgacgcactcgctcgccgaactgcacgtcgacggcgtcgagttcgacgcctcggtg
gtgttcgcgggccacggtgcggccttggacctgcctgcggcggacgaggacggtccggtc
gccgagttcgtgccgctcgccgaggcgctggcgccccggtccgccgtcgagcagctggcg
gcgctgcaggaactggtgtgtcacgaggtggcggtgacgctgggccggacggacggtcgt
ctcgtcgatccccgacggccctttcgcgacctcggtttcgactcggtcaccgccgtggag
atccgcaaccgggtgggcgccgcaaccgggctgcggctgccgcacaccctcgccttcgac
tacccgacccccgctcggctcgccgaattcctgcacgccgagctcttcggcgccgccgag
gtcgatgccgtcgtcccggttccggccgctgccgaggacccggtggtcatcgtcggcctg
gcctgccgttaccccggcggcgtcgcctcgccggaggagctgtggcgggtcgtcgccgag
ggcgtcgacgtggtgtccggtttccctgccgaccggggctgggacgtgaccggcgcctat
tcgccggtgatcgacaagcccggtcagtactaccagagcgaggcgggcttcctgcccgac
gcggacctcttcgacgcggagttcttcgggatctcgcctcgggaggcattggcgatggac
ccgcagcagcgactgctgctcgagacgtcctgggaggtgctggaacgtacgggcatcgac
ccgctgtcattgcggggcagcaggaccggggtcttcgtcggcgcgatgacgatggactac
gggccccgcctggacgccgcgtccgggcacgagggtcacgtcctgaccggtaacaccggc
agcgtcctctccgggcggatcgcctacacgctgggcctggaaggccctgcggtgaccgtg
gacacggcgtgctcgtcctccctggtcgcgctgcacctggcggcgcaggccgtacgggcc
ggggagtgcacctcggcgctggcgggcggggtgaccgtcctaccgaacctgggcatgttc
gtcgagttctcccgccatggagggctcgcaccggacggccggtgcaagcccttctccagc
accgcagacggattcggcctcgccgagggtgtgggtctggtgttggtggagcggttgtcg
gatgcccgtcgtctcggtcattcggtgttggcggtggtgcggggttcggcggtgaatcag
gatggtgcgtcgaatgggttgacggcgccgaatggtccgtcgcagcagcgggtgatccgg
caggcgttggcctcggcgggtctgtccgcggcggatgtcgacgtggtggaggcgcatggc
accggtacccggctcggcgaccccatcgaggcgcaggcagtcatcgcgacctacgggcag
ggtcgttcgcggccggtgctgctgggttcggtcaagtcgaatctcgggcatacgcaggcg
gcggcggggatcgccggggtgctgaagatggtgttggcgatgcggcacgggattgtgccc
gcgacgctgcatctcgacgagcccagtccgcaggtggactggtcggcgggcgcggtgtcg
ctggtgcccgaggccgtcgagtgggcgtcggcgggcgtgcgccgggcgggtgtctcgtcg
ttcgggatctctggcacgaacgcacacgtgatcctggaggaaccgccgtccgtgccgggc
cgctcaccggttccggtgtcctcggaccccggcgaccgtctcggcgggcggcccgccgcc
gacgcggcgtctcctgattccgccgtcgtgccggacgagtccgagacagcggcctcgggc
cgggccgaggtgacgtcctgggtcctcaccgcgaagtcggagtccgcgctgcgcgcacag
gccgagcggctgctggagttcgtccgacggccggacgtcgatcccgccgacgtggcgcac
tcgctggtgacgacgcgatccgcgttcgattaccgcgcggtcgtgatcggccgggaccgt
gccgagctgatcgacggcctggcggcggtcgccgccgcacgatcctcgacgttcgcggtc
accggctccgccgccgtgtccgggcggctggccgtgctcttcaccggtcagggcgctcag
cgggcaggcatgggctctgagctctacgcgagccacccggccttcgccgccgcgttcgac
gaggtctgcgccgagctggatccgaagctggaccggccgctgcgcgaggtcgtcttcgcc
gaggaccacgagctgctcgcacagaccggctggacgcaggcggcgctgttcgccgtcgag
gtcgcgctcttccgcctggtcgagtcgtggggcgtgcgccccgatgtcgtcggcggccat
tcgatcggggagatcgtcgcggcacatgtcgcaggcgtgctgaccctcgcggacgcctgc
accctggtggccgcccgtggatcactgatgcaggcgctgcctgcgggcggcgcgatggcg
tcggtgcgggcgagcgaggaggaggtccggccgctgctgacgtcgggcgtgtcgatcgcc
gcgatcaacggcccgcattcggtggtggtctccggcgtcgaggacgaggtggccgccctg
gccacccacttcgagaagtctcggcggctgcgcgtgagccacgccttccactcgccgctc
atggacccgatgctggcggagttcgccgaggtcgtgcggggtctggagtttcacgcgccc
cgtctcgtcgtgctgtccaacgtcacgggcggcccggcggatgccgaggagctccgcgac
ggggagtactgggtgcgtcatgtgcgcgagccggtcaggttcgccgacggcgtgcgcggg
ctggaggacgcaggcgtctcggcgctgctggagctggggccgggcggggtgttgtcggcg
atggcggcggagtcactgcgcggatcggcggtcgccgtgccgtcgctgctgacggaccga
cccgagtcgctcgccctgcggacggcggccgcgcggctcttcaccctcggcgtcccgatc
gagcgggacacgctggggacggcgggcagccggatcacgctgccgacgtacgtcttcgac
cgcacgcgtttctggctggagccccggatcaccagcggttccggggccgacgtcgagttc
tgggccgccgtcggccgaggcgacctcgacgccctcgcccgctcgctcgacctcggcgcc
gacgaacgggcgccgctggccgagctgctgccgtggctgtcctcctggtgggaacgcagg
cagcgtcgctccctggtggacggccttcgccacgaggtggtgtggcgaccgacgacaccg
tcggcggcggcctggctgtccggcgactgggcgctgatctccgaggacgccgccgacgac
ctcgccgcggcgctgtcggccgccggggcggcggtcgtccggctcaccccgaccgcactg
gccgagggcctacccgccgactgtgcgggagtggtgagcaccgtcggactgcacgccacg
ctctcgatgatccagaccctcggcgaccgcaccatccccttgtggtgcgtgacgcgcaac
ggcgtggccgccgcaggctccgacggacccgtggacccgtggcaggcggcggtgtgggga
ctgggcagggtggccgcgctcgaatcgccccgcctgtgggccgggctgatcgacctgccc
gcccgcccggacgcggcgacgctgacccggttcaccgccgtgctggccgatcccgcaggg
gaggaccaggtggcggtccggcagtcggggaccttcgtccgacggctggccagggcccgc
tccggcgcaagcggcggctggcggccctcgggcaccgtcctggtcaccggtggcaccggg
gcgctgggcggtgcggtggcgcgcctgctcgcgagcgggggagccgaccgtctcatcctg
accagccgccggggcgccgacgcaccgggcgccgccgacctcgccgccgagctgcgggcg
ctgggcgccgacgtcgacgtggtggcctgcgacgtcgccgaccgcgccgccgtcgccgcg
ctgctggccgcccacccggtcgacgcggtgttccacacggcaggtgtgctcgaggacggc
gtgctcgcctccctcacccccgagcagctggatcggacgctggccccgaaggcctggggc
gcgacccacctcgacgagctgacgcgggaccgtgagctgtcggccttcgtgctgttctcc
tcggtgaccggggtgctcggcacggcagggcagggcaactacgcggcggcgaacgccttc
ctcgacgcgctcgccgagcgccgccgcgccgaaggcctgcccgcgacggcgatctcctgg
gggccgtgggcgggtgagggcatggcggcgggccccgtcggcactcgactggccgaggac
ggcctgcgcgcgctgccggtgccgaccgccctggcggccctacagctctccctcgaccgt
ggcgagacgggggtgaccgtcgccgacgtcgactgggcgaggttcgccccgcagttcacg
gcggcgcgatggagtccgctgctggcggacctgcccgaggtcggcgcgcggaccgacgac
cgcagcccctcgaccgagctggcggccctcgatgatgccgaacgcggccgcgtcctgctg
gagctggtgcgcaccgagagtgccgccgtgctgggccaccgatccggtgccgacatcgac
gcgcatcgggtgttcaaggacctgggcttcgactcgttgaccgccgtcgcgctgcgcaac
cggatgagcgccgcgacgggcgtgctcctgtccgccgcagtggtgttcgaccacccgacg
cccgccgcactcgcggcgtacctctcccaggagacgaccggcggccgccgcgaggacgcc
cccgtcgcgccggtcacggccgccgtggcggacgacccgatcgtgatcgtcggcacggcc
tgccggttcccgggtggcgtgcgctcacccgaggacctgtggcgactgttgtcccacggc
gaggacgcgatcggcggattcccgtccgaccggggctgggacctcgacgccctctacgac
ccgaccgccgcccgttcgggaacgagctacacacgcgcgggcggcttcctgcccgacgcc
gccgagttcgacgccgccttcttcgggatctccccgcgcgaggcgctggcgatggatccg
cagcagcggctgctgttggagaccgcctgggagctcttcgaacacgcgggcatccgtccg
gcagccgtgcgcggcgagcggatcggagtgttcgtcggcaccaacggacaggactacgtc
accgacctcggcgacatcccccgcgacgtcgagggccaggtcctgaccggcaacgccgcc
agcgtcgtgtccggccgcatcgcctacacgttcgggctggagggcccggcggtcaccgtg
gacacggcgtgctcgtcgtccctggtcgcgctgcatctggccgtgcaggccctgcgcagc
ggcgagtgcacggcggccgtcgcgggcggggtcaccgtgatgtcgcgccccggggtgttc
gtggagttctcgcggcagcgcgggctttccgccgatggtcggtgcaggtcgttctcggcc
tcggcggatgggacggggtggtctgagggtgtgggtctggtgttggtggagcggttgtcg
gatgcgcgtcgtctcggtcattcggtgttggcggtggtgcggggttcggcggtgaatcag
gatggtgcgtcgaatgggttgacggcgccgaatggtccgtcgcagcagcgggtgattcgg
caggcgttggcctcggcgggtctgtccaccggggacgtggacgtggtggaggcgcacggc
accggtacccggcttggcgaccccatcgaggcccatgccctgctgaccacctacggacag
ggtcggtctcggccgttgttgttgggctcggtgaagtcgaatctcgggcatacgcaggcg
gcggcggggatcgccggtgtgctgaagatggtgttggcgatgcagcacggggtggtgccc
gagacgttgcacgtcgacgagcccacgccgcaggtggactggtcggtgggcgcggtggag
ctggccgccgagtccgtcccgtggccggacacgggccgaccccgccgcgccggggtgtcg
tccttcggcgtcagcggcacgaacgcgcacgtgatcctggaggcggcccccgcgccggaa
ccggcggcggaccagcccgagccgccgcctgctgccatcgagttcacagccgagcccgcg
acgtccccggtcgtcccatgggtgctctccgggaagtcggacgcggccctgcgcggccag
gcggctcgcctggcggagttcctccgggatcgacccgatctcccgccgacggacgtggga
gcggcactggcatcgcggtcgctgttcgaccggcgcgtgttgctcgccggtgcgaatcgg
gcggacctgctggcgagcctcgacgaggtggccgccggtcggctgactgcggggcggcgc
gccgccggtggggtggtgctggtgttccccggtcagggctcgcagtgggtcggcctggcc
gtggagctgctggcgtcctcgtcggtgttcgccgagcggatgggtgagtgtgcggcggcg
ctgtcggagttcgtcgagtggtcgctgttcgacgtgctgagtgacgaggcggcgttgtcg
cgggtcgacatcgtgcagccggtgttgttcgcggtgatggtctctttggcggagttgtgg
cgctcggtgggcgtcgtcccctcggccgtggtgggtcattcgcagggcgagatcgccgcc
gcgtgcgtcgcgggcggcctgagtctgcgggacgcggcgcgagtggtggcccggcggagt
cggctgatcgcggccctcggcggcggcggaggcatggtgtcggtggcactgccgctgccc
gaggtggccgacctgctctccggaagcgtcaccgtggcggcggtgaacggtccgtcctcg
gtggtggtctcgggtgcgcgggcgggtctgacccgggtggtggccgagtgcgagtcacgg
ggcgtccgggcccgctggatcccggtggactacgcctcgcactcggtgctgatcgaggag
atccgcgatcagctgctcgaactcctctcggagatcgagccgcgctcctcagccgtgccg
ttctactcgtcggtgacgggcacggtggtcgacaccgcgtccttggacgcgcggtactgg
ttccggaacctgcgcgagacggtgcggttcgaccgcgccgtggcggcgttgctgaccgac
ggtctcggcgtgttcgtggagtccagtgcgcatccggtgctgacctacggcattcaggag
gtcgtcgacgaacgcgacggcgatcgggatgccgccgacgcgctggtggtcggcaccctg
cgccgtgccgacggcggcatggaccgcttcctcgcctcggcgggcgagctgttcgcccac
ggcgtcgatgtcgacgtcacgcccctgctgaccggtggccgacgggtcgacctgcccgcc
tacgccttccaacgcgaccgcttctggctggcgacgcccgcctcggcgggcgacgtcgcc
tccgtcggcctcgacgccgccgatcacccgctgctcggtgcgacggtcccggtcgcgggc
tcggacgaggtcgtctgcaccggccggatctcggtcaccgaacagccgtggctggccgat
cacgtcgtcgacggggccgtgatcttccccggcacgggtctcgtggagctggcgacgaag
gccggtgcggccgtcggctgcacgcggctgcatgagctgaccctccagacgccgctggtg
gtccccgagtccggcgcggtgcgtattcaggtcgtcgtcggtccgcaggcagacgacggc
gctcgtcaggtcggcgtccatgcgcgcggtaccgacgacgacgccgtccactggacccgc
cacgcgaccggtctgctgttgcccaccctgccgcaggccgacttcgacctgacccagtgg
ccgccgaccggagccgagaccgtcgacgtcgatcacgtctacggcaggttcgcccagatc
ggcatgctctacggcccggccttccaaggactgcggcgggcgtggcgacgcgccgacgag
atcttcgtcgaggtggcgctcgccgaggaggagggcgctgcggcgcaatggttcggcgtg
caccccgcgttgctggacgcggcactgcacagcttcgcgctcgacggaagcgggccgcag
gaaccgctcctgccgttcgtctggtccgacgtgcggtcctacgcggcgggcgccacggag
ctgagggtgcgcgtgcgacggctggcggccgacacgatgtcgatccaggcagccgatgcg
tccggtgcacccgtgctgtcggccgagtcgctggtcgtgcgtcccgcgacgcgggtccgg
gccggctcttcgaaccgcgactcgctgttccgggtggagtgggtcccgacggaggccgca
ggcaggcggacggccgtctcggtgctcgatcaccaggagcgggagagcaccccgcgcacc
gccgtcggccgtgtgctgaccgagctgcagtcctggctggcgagagagccggaagagcga
ctcgtcgtgctgacccgaggcgccgtcgcggtcactccggaggagtcgcccgatctcgcg
ggcgcggccgtgtgggggctcgtgcggtcggcacagtccgagcatcccggccggatcgtg
ctggtggacaccgacggcaccgtcgacctcgaactgttggccgcgctcgacgaaccgcag
ttggcggtgcgtggtgatcgggtgttcgccgcgcggctgcggcgaatgtccgccgtggcc
gaacccgcctgggacgcctccggcacgaccttgatcaccggcggcaccgggacgctgggc
gccgccgtcgcccgacacctcgtgacgagacacggtgtccgagacctggtcctcaccagt
cggcggggcctgacggcgccggatgccgtggagctgcgggacgagctcgtcgggctcggc
gcggccgtcgtcgtcgtggcctgtgacgtggccgatcgcgagcaggtcgccgggctgttg
gcggagcacccggtcgacgccgtggtgcacacggcgggggtgctcgacgacggagtcgtg
acgtcgttgacaccggagcgcctcgacacggtgttcgccccgaaggcggacgccgcctgg
catctccacgagctcgcgggcgaactgtccgccttcgtgtccttctcgtcggcggccggg
ctcatcgggaacgccgggcagggcaactacgcggcggcgaacgccttcctggacgcgttg
gcccaccatcgccgagcacggggactgcccgcgcagtcgctggcgtggggcctgtggtcg
caggcgagcgagctgaccggggcactggacggcgcggacgtgacgcggctcggcagggcc
ggggtcgtcccgatgtccaccgaggacgggctggcccggttcgacgcggcactcggcgtc
gacgaggcctcggtggtgccgctgcggctcgacctgacggcgttccagggcgaggtgccg
cgcctgttcgccgacctcgtgcccgcccgcaggcgggcagtggcagccgcaggcaccctg
cgggaacgcatcgcagacctggacgacccccgacagaagtccctgctcggggacctggtg
cgcgcccaggcggccagagtgctcggccactcctcccccgaggccgtcgacaccgcccag
acgttccagctgctcggtttcgactcgctgacggccgtcgaactccgcaaccgcctcaac
gtcgagaccggcctgcgcctgcccgcgacgatggtgttcgactacccgacgcccggcgcg
ctcgccgacttcctgcatcagcggctgttcggccagaccgtcgcgacggcggagcccctc
gccgtggagcccggcacgacgggctcggtctcggacgacccgatcgtcatcgtcggtatg
gcctgccgtttccctggtggtgtgaacgacccggacagcctgtggcggctcctcgccgac
ggcggcgaggtcgtctccgacttcccgaccgatcgaggctggaacctccacgagctctac
gacccggaacccggcgtgcccggcaagagctacacccgcgctggcggcttcctgcgcgac
gtcgccgacttcgacgcgggattcttcgagatctcgccgcgcgaggcgctggcgatggac
ccgcagcagcgactcctgctggagacctcctgggaggtcttcgagcgggcgggcatcgac
ccggtgtcgatgcggggaagccggaccagcgtctacgcgggcctgatgtaccacgactac
gcggctcggctgcccagagtgccggaggacgtcgagggatacgcgggcaacggcaacgcg
ggcagcgtcgcctccggtcgcgtggcttatgccctgggcctggagggccctgcggtcacc
gtcgacaccgcctgttcgtcctcgttggtcgcgctgcacctggcggcgcaggccctgcgc
tccggcgagtgcgacctcgccctcgcaggcggcgtcaccgcactcgcgacgcccggcgtc
ttcgtggagttctcccggcagcgcgggctgtccgccgacggccgctgcaagtccttcgcc
ggggcggcggacggcacgggctggtccgagggtgtcggtctggtgttggtggagcggttg
tcggatgcgcggcgcaacgggcattcggtgttggcggtggtgcggggttctgcggtgaat
caggatggtgcgtcgaacggcctcaccgcgccgaacggccctgcgcagcaacgggtgatc
cggcaggcccttgcctcggccggggtgtccgccgccgacgtggatgtggtggaggcgcac
ggcacgggtactcggctgggtgatccgatcgaggcgcaggcgttgatcgcgacgtacggg
caggaccgtgcccggccgctgctgctcggttcggtgaagtcgaacctcgggcacacccag
gcggcggcgggcatcgcgggcgtcatgaagatggtgttggcgatgcgccacggggtggtg
cccaagaccttgcacgtcgacgagccgacgccgcacgtggactggtcggccggtgcggtg
gagctggtcaccgaggcgcagccgtggcccgtcgccgaccggccgcgtcgggcgggagtg
tcctccttcggcgtcagcgggacgaacgcgcacgtgatcgtggaggcgccgcccgagccc
ccggcggaccccgtggcgtccgcagcggcggccccggaccactcgatcgttccctggatt
ctctcgggcaagtcggacgccgcgctgcgtgcgcaggcagaccggttggtggacttccta
cgggcgcggccggcggtgcgtccagcggatgtcggaatgtccctggccacggcgcgagcg
cggttcgatcgccgggtgctgatctcggggtctcgcaccgacgagttcatggcgggcctg
tcggcggtcgcctccggtgcggtggttcccggtggtcgtgttgccggtggtgtggtgttg
gtgtttccgggtcagggttcgcagtgggtggggatggcggcgggtttgttggggtcgtct
cctgttttcgcgggtcggatgggcgagtgtgcggcggcgttgtcggagttcgtcgggtgg
tcgttgtttgacgttctgggtgatgagcaggcgttggggcgggttgatgttgttcagccg
gtgttgtttgcggtgatggtgtcgttggcggagttgtggtgttcggtgggtgtggttccg
tcggcggtggtgggtcattcgcagggtgagattgcggcggcggtggtgtcgggtgggttg
agtctgcgtgatggtgtgcgggtggtggttcagcggagccgtttgatcgctggtcttggt
ggtggcgggggaatggtgtcggtggcgttgcctgcgtccgaggtgacggagctgcttcct
gacggtgtgtcgttggcggcggtgaacggtccgtcgtcggtggtggtgtcgggttcggtc
tcgggtcttgagcgagtggtggccgattgtgagtcgcggggtgttcgggcgcggtgggtt
ccggtggattacgcctcgcattcggtgttgatggatgcgctgcgggacgagctggtcgag
agcctggcggatgtcgagcctcggtcgtcggagatcccgttttattcgtcggtgacgggt
gcgccgtcggacacggcgtcgttggatgcggggtattggtttcggaatctgcgggagacg
gtgcggttcgatcgtgcggtggaatcgttgctggtcggtggtttcggtgtgttcgtggag
tccagtgcgcatccggtgacgacctatggcattcaggaggtcatcgacgaacgggacggc
gacgccctggcgatcggtaccctgcgtcgggacgacggcggcatggaccgcttcctcgcc
tcggcgggcgaactgttcacccacggtgtcgacgtcgacgtcacgcccctgctggcaggc
ggtcgccaggtcgacctgccgacctacgcattccaacgtgaacgctattggctccagacg
cccaagggcttcgccggtgatctggcctcgatcgggcaacaggacgcgggccatccgctg
gtgggcgcctcggtctcgatggccgactccgacggcgtcgtgctcaccggacaggtgtcg
atcgagacgcatccgtggctggccgagcacgccgtcgccggcaccgtgctgctgccgggc
accgccttcgtcgaactcgccgtccacgcaggcgaccaggtcggctgcagtcgcgtcgcg
gagctgacgctggcggccccggtcatcctcccgccccacggcggggtcgccgtgcaggta
ctggtcggagcgccggacgagtccgggctgcggccggtgagtgtgtactcgcggcgcgcc
gatgccgagaacgacgcatggacgtgtcatgcgttcgggcagctcggggtcgaccagccg
agccgcgacctcggcctgacggcgtggccgcctgcggcgacggtcgtgccgctggccggc
gtgtacgaacgactgtacgaccagggttaccagtacgggccgatgttccagggtctgcgg
gcgatgtggcggaccgaggaggagatctacgccgaggtcatgctgcccgccgaggcgacg
accggggcgaccgccttcggcctgcatcccgcgctgctcgacgccgcgctgcatccggcc
ggagcggtcgcgcagaccgaggaggtccggctcccgttcagctggtccggcgtctcgata
catgccgcaggcgcgcgcgtgctgcgtgtccggctgacgatgcggggcgagggcgtggtc
tccctcgacgccgccgaccagaccggcgctcccgtggtctcggtggactcgctcgccctg
cgcccggtgacacccgaccagctcgccgtcgcctcgacggactcgctctaccacctcgac
tggaccggaccgcaggcactcgcgacggtcggcggcacctcggtagcctggatcggccga
gacctggacctggactcgcaggcggcggacggctccacgccggccgtcgtgctgctggac
gccgcctgcgcaggcagccaggacgcgcccacgcgggcccgccgggtcgtcggcgccgtg
ttggacgtcgtccgcgcctggctcgccgaccagcgcttcgccgacacccgcctggcggtg
gtcacgagaggcgcggtgcgtgcggtcgacggcgacgtgccggatccggcgtcggcggcc
gtctggggtctggtgcggtccgcgcagtccgagaacccggaccgactgatactgctggac
gccgaggagcacaccggtgacgcggagctgtcggcggcggcggcctgcggcgagcagcag
atcgccgtccgagccgggcagctgttcataccgcagctggcgcgcagcaggaccaccgag
tcggcggcgccctcctgggacccggcaggcgtcgtcctgatcaccggcgggaccggcacg
ctgggtgccgccgtggcccgacatctggtgcggcggcacggggtccgcaacctggtgctg
gccagtcgtcgtggactggacgcccccggtgccgtcgcgctgcgcgaggagctgaccggg
tgggacgccgaggtcgccgtggtggcctgcgacctgtccgaccgtgccgccgtggccgcg
ctgctcgctgcgcacccgatcaccacggtggtgcacagcgcaggcgccctcgacgacggg
gtggtctccgcgctgacgccggagcgggtggacacggtgttccgcccgaaggtcgacgcg
gcctggcacctgcacgaactcgcaggcgacctgtcggccttcgtgatgttctcttcggcg
tccggcgtgttcgggacagcaggacagtccaactacgcggcggccaacaccttcctggat
gcgctcgccgagcaccgcagggcgcacggcctgcctgcgcactcgctcgcctggggctgg
tgggagtcgaccagcgagatgaccgcccgactcggcgccgcagaccgatcgaggatgacg
cggcgcggcgtggtgccgctgtcgaccgacgagggactggccttgttcgacaccgccgtg
gcgggaccacgacccgtggtgctgccggtgcgactcgacctccgggccacgctgcccgcc
gtgtgccgagcactgcagcggaccacgcgccgcaccgccgccgcacccgcagcaggcgag
gcgaccttggtcgaccgcctggtgcgtctcgatccgccggaccgtgcggcagccctgttg
accctcgtccgatcggcaggcgccgaggtgctcggacacgcgaccgtcggcgaggtccgg
cccacgcgggcgttcaaggagctgggcttcgactcgctcatggccgtggagctgcgcaac
cgactccaccgcgagaccggcctgcgcctgcccgcgacgctggtgttcgactacccgacc
ccgcaggcgatcgtcggactcctggacgtggagctgttcggcgccgccgtccccgagtct
cccgcatcccccgtgctggccgacctcgaccggctggaagcaggcctgaccggcgatctc
gacgacgagacgcggtcggcggtcaccgaccggctgaaggcccttctcaccaggtggacc
ggcgatgcggcacacggctccttcgccgaccagctcgactcggcgtccgacgacgagatc
ttcaccctgatcgacaacaggctcggccgatcctga

DBGET integrated database retrieval system