KEGG   Actinoalloteichus sp. ADI127-7: UA74_19215Help
Entry
UA74_19215        CDS       T04639                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
acad  Actinoalloteichus sp. ADI127-7
Pathway
acad00473  D-Alanine metabolism
acad00550  Peptidoglycan biosynthesis
acad01100  Metabolic pathways
acad01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:acad00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    UA74_19215
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    UA74_19215
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    UA74_19215
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:acad01011]
    UA74_19215
Enzymes [BR:acad01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     UA74_19215
Peptidoglycan biosynthesis and degradation proteins [BR:acad01011]
 Precursor biosynthesis
  Amino acid ligase
   UA74_19215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp ATP-grasp_4 RimK CPSase_L_D2 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: APU15868
LinkDB All DBs
Position
4545814..4546806
Genome map
AA seq 330 aa AA seqDB search
MRQRILVIGGGQNAEHDVSTATASAVETALRERGFEVDALTIGPDGIWTHAQQSLGVRAI
DSLAAAMRIIGHADVVFPAVHGALGEDGTLAALCALAQTRVVGSDLRAGAIGMDKWATKL
VAQAVGIRTAPGRLVAANEIGDVEFEGEVVVKPVAGGSSFGVTLARDPARLHAALRTAAE
FDRRILIEEVVHGREIDVAVLGEADGTRWAAPPLEIHAHGLFDTTMKYDGSARFTVPAAL
DTADHAALTRAALTMFDALGCAGVARIDFFLTDDGPVLNEVNTMPGMTAASQVPRMFAAA
GLTYEELMSRLVDGASVPGVGLPIHARAAR
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgagacagcggatcctggtgatcggcggtggacagaacgcggagcacgacgtctcgacg
gccaccgcctcggccgtcgagacggcactgcgcgagagaggcttcgaggtcgacgcgctg
accatcggcccggacgggatctggacgcacgcgcagcagtcgctcggggtccgcgcgatc
gactcgctggcggcggcgatgcggatcatcggacacgccgacgtcgtcttccccgcggtg
cacggcgcgctcggcgaggacgggaccctggccgccctgtgcgctctcgcgcagacgcgc
gtggtcggctcggaccttcgggcaggcgcgatcgggatggacaaatgggcgaccaaactc
gtcgcccaggccgtcggaatccgcaccgcgccggggcggttggtggcggcgaacgagatc
ggcgacgtcgagttcgagggcgaagtggtcgtgaaaccggtggcgggaggctcgagcttc
ggcgtcaccctggcccgcgatcccgcccgactgcacgccgcgctccgcaccgccgccgag
ttcgaccggcggattctgatcgaggaggtcgtccacggccgggagatcgacgtcgccgtg
ctgggcgaggccgacggcacccgctgggcggcgccgccgctggagatccacgcgcacgga
ttgttcgacaccacgatgaaatacgacggctcggcccgattcaccgtgcccgccgcgctc
gacacggcagaccacgcagccctgacgagggcagcgctgaccatgttcgacgcgctcggc
tgcgcaggggtcgcccgcatcgacttcttcctcaccgacgacgggcccgtgctcaacgag
gtcaacaccatgccggggatgacggcggcctcccaggtgccgaggatgttcgcggcggcg
ggcctgacctacgaggagctgatgagccgcctggtcgacggggcgtcggtgccgggcgtc
gggctgccgatccacgcacgcgcagcgaggtga

DBGET integrated database retrieval system