KEGG   Actinoalloteichus sp. ADI127-7: UA74_22360Help
Entry
UA74_22360        CDS       T04639                                 

Definition
(GenBank) DNA polymerase LigD-like ligase domain-containing protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
acad  Actinoalloteichus sp. ADI127-7
Pathway
acad03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:acad00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    UA74_22360
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:acad03400]
    UA74_22360
Enzymes [BR:acad01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     UA74_22360
DNA repair and recombination proteins [BR:acad03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     UA74_22360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: APU16490
LinkDB All DBs
Position
complement(5303550..5304704)
Genome map
AA seq 384 aa AA seqDB search
MWVDRAGRSGAGRHVGRFRLLLSSAGRSAPAACLGLFQSAWSAGSGDDGPMSEGSGAGRQ
AERLPVLRPMLATGGQPMPTGPDWAWEFKFDGVRAIAAGDRAGVRLTSRNGNDITATYPE
LTVLGEILGAQRAVLDGEIVAMDDKGRPSFALLQRRMHVQRPTARLTGEIPVACFVFDLL
HLDGVSLLGESYLRRRELLDGLALDGRSARVRVPPSHRDVDPRRLLDIARDNGLEGTIGK
RVASGYRPGVRSRDWLKFPLINTYEVVICGWQPGGGRRAGRIGSLMLGAHDSAGELRYVG
HVGTGFTERMLAELLGMLQPIERPTSPFAGPVPREYSRAAHWVEPRLVGEVVYRTWSPDG
RLRHSAWRGLRPDRDAREISLPAW
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
gtgtgggtcgatcgggccggtcgatcgggcgcaggacgacatgtcggccgattccgtctc
ctcctctcgtccgccggccggtcggccccggccgcctgtctcggactgtttcagtcggcg
tggtcggcgggctcgggcgacgatggcccgatgtcggagggcagcggtgcaggcaggcag
gcggagcgtcttcccgtgctccggcccatgctcgcgaccggcgggcagccgatgccgacg
ggtccggactgggcctgggagttcaagttcgacggcgtgcgggccattgcggcaggcgat
cgggcgggcgtccgcctgacgagccgaaacgggaacgacatcacggcgacctacccggag
ctgacggtgctcggcgagatcctcggcgcgcagcgggccgtgctggacggcgagatcgtc
gccatggacgacaagggcaggccctcgttcgcgctgctgcaacgtcgaatgcacgtccaa
cggccgaccgcccgactgaccggggagatcccggtcgcctgcttcgtcttcgacctgctc
cacctcgatggcgtctcgctgctcggcgagtcctacctccggcggcgggagctgctcgac
ggcctggcgttggacggtcggtccgctcgggtccgagtgccgccgagccaccgggacgtc
gacccccggcggctgctcgacatcgcccgcgacaacggactggaaggcacgatcggcaag
cgggtcgcgtcgggctatcggccaggagtccgcagccgcgactggttgaagttcccgctg
atcaacacctatgaggtggtgatctgcgggtggcagccgggcgggggacggcgggccggg
cggatcggctcgctgatgctcggcgcccatgactcggcaggcgagctgcggtacgtgggg
cacgtcggaaccgggttcacggagcggatgctcgccgagctgctcggcatgctccagccg
atcgaacggccgacgagtccgttcgccgggccggttccgcgcgagtactcccgcgccgcg
cactgggtcgagcctcggctcgtcggggaggtcgtctatcggacgtggagccccgacggc
aggctccggcactcggcctggcgcggccttcgccccgaccgggacgcacgggagatcagc
ctgcccgcctggtag

DBGET integrated database retrieval system