KEGG   Acinetobacter calcoaceticus: BUM88_04125
Entry
BUM88_04125       CDS       T05452                                 

Definition
(GenBank) thioredoxin-disulfide reductase
  KO
K00384  thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
acal  Acinetobacter calcoaceticus
Pathway
acal00450  Selenocompound metabolism
Brite
KEGG Orthology (KO) [BR:acal00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BUM88_04125
Enzymes [BR:acal01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.9  thioredoxin-disulfide reductase
     BUM88_04125
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox Pyr_redox_3 GIDA FAD_oxidored NAD_binding_7 NAD_binding_8 HI0933_like K_oxygenase FAD_binding_2 AlaDh_PNT_C Thi4 FMO-like Shikimate_DH Staph_opine_DH
Other DBs
NCBI-ProteinID: AQZ80858
LinkDB
Position
complement(851495..852445)
AA seq 316 aa
MSARHSRLIILGSGPAGYSAAVYAARANLKPTLIAGLQLGGQLTTTTEVDNWPGDPEGLT
GPALMDRMQAHAERFGTELVYDHINEVDLNVRPFVLKGDMEEYTCDALIIATGATAQYLG
LESEQKFMGQGVSACATCDGFFYKNQKVMVVGGGNTAVEEALYLSNIAAHVTLVHRRDSL
RSEKILQDHLFAKEKEGKISIIWNHEVEEVLGDNTGVTSVRLKSTQDETKQDVEVHGLFV
AIGHKPNTAMFDGQLNLRDGYIQVQSGTSGNATATSVAGVFAAGDVADSIYRQAITSAGS
GCMAALDAEKYLDNLG
NT seq 951 nt   +upstreamnt  +downstreamnt
atgagtgctcgtcattctcggttaattattctcggttctggtcctgctggttatagtgca
gctgtctatgcggcacgtgccaaccttaaacctactttaattgcaggtttacaactaggt
ggccaacttacaacaacaaccgaagttgacaactggccgggcgatcctgaaggtttaaca
ggtcctgcattaatggatcgtatgcaagcacatgctgaacgctttggtacagaactcgtc
tatgaccatattaacgaagtggacttaaatgtacgtccttttgttcttaaaggtgatatg
gaagagtacacatgtgatgctttgattattgcaactggtgctacggctcagtaccttggt
ctagagtctgaacagaaatttatgggccaaggcgtaagtgcctgtgcaacatgtgatggt
ttcttctacaaaaatcaaaaagtgatggttgtaggtggtggtaacactgcagttgaagaa
gcgctttatttatcaaatattgctgcacatgtaacgctagtacaccgccgtgatagctta
cgttctgaaaagattttgcaagatcatttatttgccaaagaaaaagaaggcaaaatcagc
attatctggaatcatgaagttgaagaagtattgggtgacaatactggcgtaacaagtgtt
cgccttaaatcaactcaagatgaaactaagcaagacgtagaagttcacggtctattcgtt
gcaatcggtcataaaccgaacactgcaatgtttgatggtcaattaaacttacgtgatggc
tatattcaagtgcaaagcggcacttcaggtaatgcaacagcaacttctgtagctggtgtt
tttgctgctggtgacgtagctgacagtatttatcgtcaagccattacttctgctgggtca
ggttgtatggcggcacttgatgctgaaaaatatctagataatctcggttaa

DBGET integrated database retrieval system