KEGG   Acinetobacter calcoaceticus: BUM88_04805
Entry
BUM88_04805       CDS       T05452                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K05297  rubredoxin---NAD+ reductase [EC:1.18.1.1]
Organism
acal  Acinetobacter calcoaceticus
Pathway
acal00071  Fatty acid degradation
Brite
KEGG Orthology (KO) [BR:acal00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BUM88_04805
Enzymes [BR:acal01000]
 1. Oxidoreductases
  1.18  Acting on iron-sulfur proteins as donors
   1.18.1  With NAD+ or NADP+ as acceptor
    1.18.1.1  rubredoxin---NAD+ reductase
     BUM88_04805
SSDB
Motif
Pfam: Pyr_redox_2 Rbx_binding Pyr_redox Pyr_redox_3 DAO Lycopene_cycl TrkA_N NAD_binding_8 DUF1188 NAD_binding_9 ThiF NAD_binding_7 Shikimate_DH K_oxygenase 3HCDH_N HI0933_like Sacchrp_dh_NADP Amino_oxidase PS_pyruv_trans ApbA
Other DBs
NCBI-ProteinID: AQZ80980
LinkDB
Position
complement(1003017..1004198)
AA seq 393 aa
MHPIVIIGSGMAGYTLAREFRKLSPEQELVMICADDAVNYAKPTLSNAFAGKKAPEQIPL
GDATKMGTQLNMRIEPFTFVKEILAERHELVLEKDGVTSQQPYSKLILAVGANPIRLAIA
GDGSDDIHVVNSLIDYRAFRENLAQRKDKRVVILGAGLIGCEFANDLLHSEYDITVIDLA
PQPLGRLLPSHIASAFQQNLEEAGVKFALGTTVEKVSKINNGEDYAITLANGQTLVADIV
LSAIGLQPNISVAQSADIQTSRGIITNSLLETNQADIYAIGDCAEVNGTLLPYVMPIMQQ
ARALAKTLSGQQTTVHYPAMPVAVKTPAAPLTVLPAPVDVEVNWETEEFDDGMLAKAIDN
EGTLRGFVLLGATAGKQRLTLTKLVPDLIPAQA
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgcatcctatcgtcattatcggatcaggcatggcgggttataccttagcacgtgagttc
cgtaagcttagcccagagcaagaacttgtgatgatttgtgcggatgatgcagtgaactat
gcaaagccaacattatcaaatgcatttgcaggtaaaaaagcacctgaacaaattccttta
ggcgatgcgacaaaaatgggtactcaactcaatatgcgtattgagccttttacctttgtg
aaagaaattttagctgaacgccatgagcttgttcttgaaaaagatggtgtaacttcacaa
caaccctattcaaaattgattttagccgtgggtgctaacccaattcgccttgcaattgct
ggtgatggtagcgatgacattcatgttgtgaactcactcattgattaccgtgcttttcgt
gaaaatctagctcagcgtaaagacaaacgtgttgttattttgggtgcaggtttaattggt
tgcgaatttgccaacgacttacttcatagtgaatatgacatcactgtcattgatttagca
ccgcaaccattaggtcgtttacttccatcacatattgcttctgctttccagcaaaatctt
gaggaagctggagtaaaatttgcactcggaaccactgttgaaaaagttagcaaaattaat
aatggcgaagattatgcgataacactcgcaaacggacaaacattggttgcggacattgtt
ctttctgcgattggcctacagccaaatatttcagttgctcaaagtgcagatattcaaacg
agccgtggaattattaccaatagtttactagaaacaaatcaagcagacatttatgcaatt
ggggattgcgcagaggtaaatggtactttacttccatatgtaatgccgattatgcaacaa
gctcgtgccctcgcgaaaacactcagtggacaacaaactaccgttcattaccctgcaatg
ccagttgcagtaaaaacgccagctgcaccacttacagttttgcctgctccagttgatgta
gaagtgaactgggaaacagaagaattcgacgatggtatgcttgccaaagcaattgacaat
gaaggaacattgcgtggttttgtattgttaggtgcaaccgcaggtaaacaacgcttaact
ttgacaaagcttgtcccagatcttattccagcccaagcataa

DBGET integrated database retrieval system