KEGG   Acinetobacter calcoaceticus: BUM88_05720Help
Entry
BUM88_05720       CDS       T05452                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
acal  Acinetobacter calcoaceticus
Brite
KEGG Orthology (KO) [BR:acal00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BUM88_05720
Enzymes [BR:acal01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BUM88_05720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored HI0933_like DAO FAD_binding_3 Thi4 AlaDh_PNT_C K_oxygenase NAD_binding_8 Cytochrom_C_2 FMO-like Spermine_synth Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: AQZ81140
LinkDB All DBs
Position
complement(1199878..1201443)
Genome map
AA seq 521 aa AA seqDB search
MLDQNIKTQLKAYLERLESPIELVAALDESDKAAQIKELVTEIAELSDKVTARFDGNNTR
RPSFGVAKAGEQPRVLFAGLPMGHEFTSLILALLQVSGYAPKVSNEVLNQIKGLNLKADF
DVFVSLSCHNCPDVVQALNLIAIYNPNTTATMIDGSFFQDEVEQRKIMAVPMVFQNNEHI
GQGRMTLEEIVAKLDTNSAEKDAAALNAKDAFDVLVIGGGPAGATAAIYAARKGINTGIV
AERFGGQVMDTMDIENFTSVQKTQGPKFAAEMEAHVREYDVDIMNLQRVSKITGANQTAN
GLVEVELENGAKLESKTVILSTGARWREMNVPGEQEYRTRGVAYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVEHVTLVEFDTKLRADQVLQNKLHSLPNTTVIMNALSTEVLGD
GSQVTGLKYKDRATDQEHVVELAGIFVQIGLLPNTDFLKDSEVELTNRGEIIVNDRNETN
VKGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYIIRSGQ
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgttagatcaaaacattaaaactcaattaaaagcttacctagaacgtttagaaagtcca
atcgaattagttgctgctttagatgagtcagataaagcggctcaaattaaagagctggtt
accgaaattgctgaactttctgacaaggtcactgcacgttttgatggcaacaatacacgt
cgtccaagctttggtgtggctaaagcaggtgaacaacctcgtgtgctctttgccggctta
ccgatgggccatgagtttacatctttgatcttggcactgttacaggtgtctggctatgct
cctaaagtgtcaaatgaagtattgaaccagattaaaggcttaaaccttaaagctgacttt
gatgtgtttgtatcgctaagctgtcataactgtccggacgtggtacaggcgcttaacctg
attgcgatttataacccgaacacaactgcaaccatgattgatggttcattcttccaagac
gaagtagaacaacgcaaaatcatggcggttccaatggtgttccagaataatgagcacatt
ggtcaaggtcgtatgacccttgaagaaatcgtagcaaaactcgacaccaactcagctgaa
aaagatgcagcagcgcttaatgccaaagatgcgtttgatgtgttagtgattggtggtggt
cctgcgggtgcaacagctgccatctatgcagcacgtaaaggcatcaacacaggtatcgtg
gctgaacgcttcggtggtcaggtgatggataccatggacattgaaaacttcacgtctgta
caaaaaactcaaggtcctaagtttgctgccgaaatggaagcacatgttcgtgaatatgat
gttgatattatgaatttacaacgtgtcagcaaaatcacaggtgcaaatcaaactgcaaat
ggtctggttgaagttgaactcgaaaatggtgcaaagcttgaatcgaaaacagtaatcctt
tcaacaggtgcacgttggagagaaatgaatgtaccgggtgagcaagaataccgtacccgt
ggtgtcgcgtactgcccacactgtgatggccctttgttcaaaggcaaacgtgttgccgtg
attggtggtggtaactcgggtgtagaagctgcgattgaccttgcagggattgttgagcat
gtgactttggttgagttcgatactaaactccgtgctgatcaagtcttgcaaaacaaactg
catagcttgccaaacacaactgtgatcatgaatgccttaagtacagaagtgttaggtgat
ggttcacaagtaactggtcttaaatataaagatcgtgccactgatcaagagcatgtagtt
gagcttgctggaatctttgtacagattggtttattaccaaacactgacttcttaaaagac
agtgaagttgagttaaccaaccgcggtgagatcattgtgaatgaccgcaacgaaaccaat
gtgaaaggtgtgtttgctgcgggtgactgtactacagttccgtacaaacaaatcattatt
gccacaggtgaaggcgcgaaagcatcactctctgcttttgattacatcattcgttcgggg
caataa

DBGET integrated database retrieval system