KEGG   Acinetobacter calcoaceticus: BUM88_09170Help
Entry
BUM88_09170       CDS       T05452                                 

Definition
(GenBank) diaminohydroxyphosphoribosylaminopyrimidine deaminase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
acal  Acinetobacter calcoaceticus
Pathway
acal00010  Glycolysis / Gluconeogenesis
acal00020  Citrate cycle (TCA cycle)
acal00620  Pyruvate metabolism
acal01100  Metabolic pathways
acal01110  Biosynthesis of secondary metabolites
acal01120  Microbial metabolism in diverse environments
acal01130  Biosynthesis of antibiotics
acal01200  Carbon metabolism
Module
acal_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:acal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BUM88_09170
   00020 Citrate cycle (TCA cycle)
    BUM88_09170
   00620 Pyruvate metabolism
    BUM88_09170
Enzymes [BR:acal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BUM88_09170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2 RnfC_N
Motif
Other DBs
NCBI-ProteinID: AQZ81766
LinkDB All DBs
Position
1868851..1870389
Genome map
AA seq 512 aa AA seqDB search
MSEIKTLEIPKWGLSMEEGTIAQWLIKEGDSFNKGDEICEIETTKIVNVLEAPFAGTLRK
ILAKDGDTLPVGGLIAVCAESQVSDAEIEKFIASLGGSAAKAPEPSPEQSKAEISAPIVE
KTDQLQTVAASASAPVKAVKGDYAVPESLQGYQTSDELFATPHALKLAKKHNVNLAKVTG
SGREGRISVQDIQKAVQAAGGQWPDVKQQHQAKVVKSTADDSRVLATPVARRLAKQWGIN
LNDCRISGTRGRVCKEDVEAVYNRNNPTVGSEQSTPCAVAQPQSTITTVAMNGMRKAIAS
RLQAAKRNAPHFRLVVDLNVEALQNLRKQINESVPQVKLSINDMLIKAAAAALIKVPEVN
VQFDEATQSILQFSQADISVAVAIPNGLITPIVKAANQKSLAQISDDMRDLATRAKTGKL
QPDEFQGGSFSISNLGMLGIKQFDAIINPPQGAIMALGASELRAVVENGNVVVREIVTAT
LSCDHRVIDGAVGAKFLASFKQFVENPALILV
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaattaaaacgctggagatcccgaaatggggattatccatggaagaaggcacg
attgcccaatggttgattaaagaaggcgatagctttaataaaggcgatgaaatttgtgaa
attgaaaccacgaaaattgtcaatgtattagaagctccttttgcgggaacactgcgtaaa
atcttagcaaaagacggtgatactttacctgtaggcggtcttattgctgtgtgtgctgaa
agccaagtttctgatgcagaaattgagaagtttattgcatcattaggtggttcagcagct
aaagcacctgaaccatctccagaacaaagtaaagcggaaatatctgcacctattgttgaa
aaaacggatcaactacagactgtagcagctagcgcctcagctccagtaaaagcagttaaa
ggtgattacgctgtacccgagtcattacaaggctatcaaacatctgatgagctttttgca
actccgcatgccttgaaacttgctaaaaaacataatgttaatttggcaaaagtgacgggt
tctggtcgtgaagggcgtattagtgttcaggacatccagaaggctgtgcaagctgctgga
ggccagtggcctgatgttaaacagcaacatcaagctaaagtagttaaatctactgccgat
gatagccgtgttttggcaacacctgttgcacgccgtttggcaaagcaatggggcattaac
cttaatgactgccgtatttcaggtactcgtggccgcgtttgcaaagaagatgttgaagcg
gtttacaaccgtaataacccaacggtgggaagtgaacagtctactccgtgtgctgttgct
caaccacaatcgacaattacgactgtcgcaatgaatgggatgcgtaaagcgattgcctca
cgcttgcaagctgcaaaacgtaatgcgccgcatttccgtcttgtagtcgatctaaacgta
gaagcacttcaaaatttacgtaagcagattaatgagagtgttccacaggtgaagctatct
attaatgacatgcttattaaagccgccgccgccgcactcattaaagtacctgaagtgaat
gttcaatttgatgaagccacacagtcgattctgcaattttcacaagcagatatttcggtg
gctgtggcgattccaaacggtttaattacaccaattgtgaaagccgccaatcagaagtct
ttagcacagatttccgatgatatgcgtgatttggcaacgcgtgccaagactggaaagtta
caacctgatgaatttcagggaggcagctttagcatttccaatttaggaatgttaggcatt
aaacagttcgatgccatcattaatccaccgcaaggtgcaattatggcattgggtgcttca
gaactacgtgctgtcgttgaaaatggaaatgttgtggttcgtgagattgtcacagcgaca
ttgtcatgtgatcaccgagtcattgacggtgctgtaggtgcaaagttcttggccagcttt
aagcagtttgttgaaaacccagctttaattttggtgtag

DBGET integrated database retrieval system