KEGG   Acinetobacter calcoaceticus: BUM88_09180Help
Entry
BUM88_09180       CDS       T05452                                 

Definition
(GenBank) diacetyl reductase
  KO
K03366  meso-butanediol dehydrogenase / (S,S)-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.- 1.1.1.76 1.1.1.304]
Organism
acal  Acinetobacter calcoaceticus
Pathway
acal00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:acal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BUM88_09180
Enzymes [BR:acal01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.76  (S,S)-butanediol dehydrogenase
     BUM88_09180
    1.1.1.304  diacetyl reductase [(S)-acetoin forming]
     BUM88_09180
    1.1.1.-  
     BUM88_09180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR Polysacc_synt_2 3HCDH_N Epimerase Methyltransf_31 WcbI Ldh_1_N Methyltransf_25 Methyltr_RsmB-F
Motif
Other DBs
NCBI-ProteinID: AQZ81768
LinkDB All DBs
Position
1871831..1872616
Genome map
AA seq 261 aa AA seqDB search
MVKGLKDRVALVTGAAQGIGRGIALRLAQDGVHIALVDMKQDRLNAVQQEIQALGVNAST
FIADVSDREQVYAAINHAEQTLGGFDIMINNAGIAQVQAIADTTPDEFHKIVDINIGGVL
WGIQAAAAKFKQRQHKGKIINACSIAGHDGFALLGVYSATKFAVRALTQAAAKEYASHGI
TVNGYCPGIVGTDMWVEIDKRFAEITGSAIGETYKKYVEGIALGRAQTPEDVAALVAFLA
SEDSDYITGQSILTDGGIVYR
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggttaagggattaaaagatagggtcgctttagtgacaggggcagctcaaggcattggc
cgtgggattgccctgcgcttggcgcaagatggtgttcacattgcattggtcgatatgaaa
caagatcgactcaatgctgtacagcaagagattcaagctttaggcgtaaatgccagtacg
tttattgccgatgtcagtgaccgcgaacaagtgtatgccgctataaatcatgctgagcag
acacttggtggctttgacatcatgattaataatgctggaattgctcaggttcaggctatt
gcagatacgacaccagatgaatttcacaaaatcgttgatatcaatattggcggtgtactg
tggggcatacaggctgctgctgcaaaatttaagcaacgccaacataaaggtaaaatcatt
aatgcttgttcaattgcaggccatgatgggtttgctttgctgggtgtttattcggcaacc
aagtttgcagtgcgtgcgcttacacaagccgcagcaaaagaatatgcaagtcacggtatt
acggtaaacggatattgtcccggaattgttggaaccgacatgtgggttgaaatcgataaa
cgttttgctgaaattactggttcggctataggtgagacctataaaaaatatgtagaaggc
attgctttaggtagagcccaaacaccagaggatgtcgctgcattagttgcttttctagca
agtgaagattcagattacattacgggtcaatcgattttaacggacggcggaattgtctat
cgttaa

DBGET integrated database retrieval system