KEGG   Acinetobacter calcoaceticus: BUM88_09185Help
Entry
BUM88_09185       CDS       T05452                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
acal  Acinetobacter calcoaceticus
Pathway
acal00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:acal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BUM88_09185
Enzymes [BR:acal01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     BUM88_09185
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     BUM88_09185
    1.1.1.-  
     BUM88_09185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 Semialdhyde_dh 2-Hacid_dh_C FAD_binding_3 TrkA_N Ret2_MD NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AQZ81769
LinkDB All DBs
Position
1872646..1873704
Genome map
AA seq 352 aa AA seqDB search
MKAARFYDRGDIRIEDIPEPEVTPGTVGIKVAWCGICGTDLHEFMEGPIFIPPCGHPHPI
SGESAPITMGHEFSGVVYAVGEGVDDIEVGQHVVVEPYIVAEDVPTGPGDNYHLSKNMNF
IGLGGRGGGLSEKIAVKRRWVHPISNKIPLDQAALIEPLSVGHHAYVRSGAKTGDIALVG
GAGPIGLLLSAILKAKGLKVIITELSAKRKEKAKESGVADYILDPSEADVVSEVMKITNG
DGVDVAFECSSVNKVLDTLVAAMKPTGVIVIVSIWSHPASINVHSVVMKELDVRGTIAYV
NDHQETIKLVEEGKINLEPFITQRIQLDDLISQGFETLIHNNESAVKIIVQP
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcgcgtttttatgacagaggcgatatccgtattgaggatatcccagaacca
gaagtcactcccggcactgtaggcattaaggttgcttggtgtggaatttgtggtacagat
ttgcatgaatttatggaaggaccgatttttattccaccgtgtggacatcctcatcctatt
tcaggcgaatctgcgccgattacgatgggacatgagttttctggtgtagtctatgccgta
ggtgaaggtgttgatgatattgaagtcggtcagcatgtggtcgtagagccttatattgtg
gctgaggatgttccgactgggccgggagataattatcatctttccaaaaatatgaacttt
attggtttaggtggtcgtggcggcggtctatcggaaaaaattgcggttaaacgccgttgg
gtacacccaatctctaataaaattccacttgatcaagctgcattgattgaaccgttatcg
gttggtcatcatgcttatgtccgcagtggcgcgaagactggtgatattgcactggttggt
ggtgcaggaccaattggtttactactttcggcaattttaaaagcgaaagggcttaaagtc
atcattactgagttgagtgcaaaacgtaaagaaaaagccaaagagtcgggagtcgcagat
tatattttagatccatcagaggctgatgtggtttctgaggttatgaaaatcaccaatggt
gatggtgtcgatgtcgcgtttgaatgtagtagcgttaacaaagttctagatactttggtt
gcggccatgaaaccaacaggcgtgatagtgattgtttcgatctggagccatccagcatca
attaatgtgcatagtgtggtgatgaaagagctggatgtacgaggcacaattgcctacgtc
aatgaccatcaggaaaccattaaactggttgaagaaggtaaaataaatctagaacctttt
attacccagcgtattcaacttgatgatttgatttcacaaggttttgaaaccttaattcat
aacaatgagtccgccgttaagattattgtacagccataa

DBGET integrated database retrieval system