KEGG   Acinetobacter calcoaceticus: BUM88_09245
Entry
BUM88_09245       CDS       T05452                                 

Definition
(GenBank) fumarate reductase/succinate dehydrogenase flavoprotein subunit
Organism
acal  Acinetobacter calcoaceticus
SSDB
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 HI0933_like Thi4 DAO GIDA FAD_oxidored Trp_halogenase Lycopene_cycl NAD_binding_8 Pyr_redox_3
Other DBs
NCBI-ProteinID: AQZ81780
LinkDB
Position
1884809..1886542
AA seq 577 aa
METKYLEFDIVVIGGGTAGPMAAIKAKQENPNLKVLLIEKANVKRSGAISMGMDGLNNAV
IPGYATPEQYTKEITIANDGVVNQATVYAYAKHSFKTIQQLDQWGIKFEKDETGEFAVKK
VHHMGAYVLPMPEGHDVKKVLYRQLKRAQVKINNRIVTTKLLKNEQGAINGVLGFDCRSG
DFYVIKTKAAILCCGAAGRLGLPASGYLMGTYENPTNAGDGYAMAYHAGAELANLECFQI
NPLIKDYNGPACAYVTGPLGGYTANSKGERFIECDYWSGQMMWEFYQELESGNGPVYLKV
DHLAEETIQTIEEILHTNERPSRGRFHEGRGTNYRQDMVEMHISEIGFCSGHSASGVWVN
EKAETSVKGLYSAGDMAAVPHNYMLGAFTYGWFAGVNAAQYVSSIEDSELNQSEIEAEKA
RIFAPLDCSEGLPAEQVEYKLRRFVNDYLQPPKTRQKMEIGLKRFEEIKQDIARITARNP
HELMRAAEVSFIRDCAEMAARASLFREESRWGLYHYRADFPQKNNSDWFCHAHLKKDEHG
NMTSFKKTIEPYVVPINQDEAVSYDRLRIQKDVALAD
NT seq 1734 nt   +upstreamnt  +downstreamnt
atggaaactaaatatcttgagtttgatattgtggttattggtggtggaactgctgggcca
atggcagcaattaaagcaaaacaagaaaaccctaatttaaaagtcttactgatcgaaaaa
gcgaatgtaaaacgtagcggtgctatttcaatgggtatggatgggcttaataatgccgtc
attccagggtacgcaacaccagagcaatataccaaagaaattacgattgccaacgatggc
gttgtgaaccaagcaaccgtatatgcatatgcaaagcacagttttaaaacgatccaacag
ctcgatcaatggggaattaaatttgaaaaagatgaaacaggtgagttcgcagtaaaaaaa
gtacatcacatgggggcatatgttttaccaatgcctgaaggccatgatgtaaaaaaggtt
ttatatcgtcagttaaaacgcgcccaagtcaaaattaacaaccgaattgtgactacaaag
cttttaaaaaatgagcaaggtgcaatcaatggagtactgggctttgattgtcgtagtggc
gatttctatgtcattaaaactaaagctgccattttatgttgtggtgcagcagggcgttta
ggtctgccagcttcaggttacttaatgggaacttatgagaatccaaccaatgcaggcgat
ggttatgccatggcataccatgcaggtgctgagcttgccaatttagaatgctttcagatc
aatccgctgattaaagattataacggtccagcttgtgcctatgtcacaggcccattgggt
ggatataccgccaatagtaaaggtgaacgtttcattgagtgcgactactggagtggtcaa
atgatgtgggagttttaccaagagttggaaagtggtaatggtccagtttatttaaaggta
gatcatctggctgaagaaacgattcaaaccattgaagagattttacataccaatgagcgc
ccaagtcgtggacgttttcatgagggccgaggaaccaattatcgtcaagatatggtggaa
atgcatatttcagaaattggtttttgtagtggacacagtgcttctggtgtatgggtcaat
gaaaaagccgaaacttcagttaaaggtttatatagcgctggcgatatggcagctgtacct
cataactatatgcttggtgcatttacctatggctggtttgctggagtaaacgctgcgcaa
tacgtgagttcaattgaagatagcgaattaaaccaaagtgaaatagaagcagagaaagca
cgaatctttgcaccacttgactgttccgagggcttacccgccgagcaagtggaatataag
ctgcgccgttttgtaaatgactatttgcagccacccaaaactcgccaaaaaatggaaatt
gggctcaagcgttttgaagaaatcaaacaggatattgctcgaatcactgccagaaatcca
catgaattgatgcgtgctgctgaagtttcttttattcgagactgtgcagaaatggcagct
agagcctcactttttagagaagaaagccgttggggactttatcactaccgagcagatttc
cctcaaaaaaataactcggattggttctgtcacgcacatttgaaaaaagatgaacacggc
aacatgaccagtttcaaaaaaacaatcgagccttatgtggttccgattaatcaagatgaa
gctgtgtcttatgaccgtttacgcattcaaaaagacgttgctctagcagactaa

DBGET integrated database retrieval system