KEGG   Acinetobacter calcoaceticus: BUM88_11260Help
Entry
BUM88_11260       CDS       T05452                                 

Definition
(GenBank) beta-hydroxyacyl-ACP dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
acal  Acinetobacter calcoaceticus
Pathway
acal00061  Fatty acid biosynthesis
acal00780  Biotin metabolism
acal01100  Metabolic pathways
acal01212  Fatty acid metabolism
Module
acal_M00083  Fatty acid biosynthesis, elongation
acal_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:acal00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BUM88_11260
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BUM88_11260
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:acal01004]
    BUM88_11260
Enzymes [BR:acal01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     BUM88_11260
Lipid biosynthesis proteins [BR:acal01004]
 Fatty acid synthase
  Component type
   BUM88_11260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas
Motif
Other DBs
NCBI-ProteinID: AQZ82142
UniProt: A0A0A8XCA4
LinkDB All DBs
Position
complement(2313649..2314134)
Genome map
AA seq 161 aa AA seqDB search
MTESTTPKFAIPELPMQIQTIRQYLPHRYPFLLVDRVTEVTDNSIVGYKNVSINEEFLQG
HFPEYPIMPGVLIVEALAQVSGVLGFIMNNETPKPGSLFLFAGAERVRFKKQVVAGDQLV
LKSELVMQKRGIYKYNCTATVDGIVATTAEIMISHQKTEQA
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagtcaactacacctaaatttgccatccctgaattaccaatgcagattcaaacg
attcgtcaatatttgccgcatcgttacccattcttattggttgatcgtgtgactgaagtt
actgacaatagtattgttggttataaaaatgtttctatcaatgaagagttcctacaggga
catttcccagaatatccaattatgcctggtgttctaattgtagaagcattagctcaagtt
tcaggtgttctagggtttattatgaacaatgaaacaccaaaacctggttctttattcctc
tttgctggtgcggaaagagttagatttaaaaaacaagtagttgccggtgaccaacttgta
ttaaaatctgaattagtaatgcaaaaacgcggtatctacaaatataactgtacggctacc
gttgacggtattgtagcaacaaccgctgaaattatgatttcacaccaaaaaacagagcag
gcatga

DBGET integrated database retrieval system