KEGG   Acinetobacter calcoaceticus: BUM88_12390
Entry
BUM88_12390       CDS       T05452                                 

Definition
(GenBank) tRNA uridine-5-carboxymethylaminomethyl(34) synthesis enzyme MnmG
  KO
K03495  tRNA uridine 5-carboxymethylaminomethyl modification enzyme
Organism
acal  Acinetobacter calcoaceticus
Brite
KEGG Orthology (KO) [BR:acal00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:acal03016]
    BUM88_12390
   03036 Chromosome and associated proteins [BR:acal03036]
    BUM88_12390
Transfer RNA biogenesis [BR:acal03016]
 Eukaryotic type
  tRNA modification factors
   Other tRNA modification factors
    BUM88_12390
 Prokaryotic type
    BUM88_12390
Chromosome and associated proteins [BR:acal03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    BUM88_12390
SSDB
Motif
Pfam: GIDA GIDA_assoc FAD_oxidored Pyr_redox_2 FAD_binding_2 DAO HI0933_like AlaDh_PNT_C Pyr_redox Thi4 Pyr_redox_3
Other DBs
NCBI-ProteinID: AQZ82345
LinkDB
Position
complement(2555110..2556990)
AA seq 626 aa
MHYPKVYDVIVIGGGHAGTEAALAAARMGRQTLLLTHNIETLGQMSCNPAIGGIGKSHLV
REIDALGGAMALAADKGGIQFRILNSRKGAAVRATRAQADRVRYKAAIRDTLENQANLDI
FQQAADDLIVEGDTVKGVVTQMGIRFDAKTVVLTTGTFLGGVIHVGLEKSSGGRAGDPPS
IALAQRLRELKLPVGRLKTGTPPRIDARSVDFSVMIPQPGDFPSPVMSFMGDASMHPEQV
NCYITHTNEKTHDIIRGGLDRSPMYTGVIEGVGPRYCPSIEDKIHRFADKDSHQVFLEPE
GLDTHELYPNGISTSLPFDVQFELVRSIRGMENAHILRPGYAIEYDYFNPQALKFTLETK
AINGLYFAGQINGTTGYEEAGAQGLLAGLNAARRAWEQEEWTPKRDQAYMGVLVDDLITL
GTKEPYRMFTSRAEYRLMLREDNADQRLTTVGRELGLVDDVRWAAYCEKMEAVERETSRL
QHLWAAPNNPMGKKFVEMTGADLSKECSAIDLLKRPNINFGQIAELTGSEVSEQVGEQIE
IAVKYEGYINRQHEDVAQLKRLEETKIPTDFNYDVVSGLSREITQKLKTVLPETLAQASR
IPGVTPAAVQLVMITIRKNNMIKKTA
NT seq 1881 nt   +upstreamnt  +downstreamnt
atgcactaccctaaagtttatgatgttatcgttatcggtggcggtcacgcaggtacggaa
gcggcccttgctgctgcgcgtatgggacgacagactttgcttttgacccataacattgag
actttgggtcaaatgagttgtaacccagcaatcggtggtattggtaagtcacatttagta
cgtgaaattgatgcacttggcggtgcaatggctttagctgccgataaaggtggtattcag
ttccgtattttaaattcacgtaaaggtgcggcagtacgtgcaacacgtgctcaagctgac
cgcgttcgctataaagctgccatccgcgatactttagaaaatcaagcaaatcttgatatt
tttcagcaagcggctgatgacctgattgttgaaggtgatacggttaaaggtgttgttacc
caaatgggtattcgctttgatgctaaaactgttgtgttgactacgggtacattcttgggt
ggggtaatccacgttggtttagaaaaatcaagcggtggtcgtgcaggtgatcctccttca
attgcacttgctcagcgtctacgtgaattaaaattacctgtgggtcgtttaaaaacgggg
acaccaccacgtattgatgcacgttcggttgatttttcagtcatgattccacagccgggt
gatttcccatctccggttatgtcattcatgggtgatgcttctatgcaccctgaacaagta
aattgttatatcacgcataccaatgaaaaaacccatgacattattcgtggtggtttagat
cgttcaccaatgtataccggtgttattgaaggtgtagggccacgttactgcccatcaatc
gaagataaaattcaccgtttcgcagataaagattctcatcaggtattcttggaaccagaa
ggtttagatacacatgaactttatccaaatggtatttcgacttcgcttccatttgatgtt
cagttcgagctggttcgttctattcgtggtatggaaaatgcccatattttgcgtccaggc
tatgcgattgaatacgattatttcaatccgcaagctttgaaattcactctcgaaactaaa
gctattaacgggttgtattttgctggccaaattaacggtacaacaggttacgaagaagca
ggtgctcaaggtttacttgctggcttaaacgctgcgcgccgtgcttgggaacaagaagag
tggacacctaagcgtgatcaagcttacatgggtgtattggttgatgacctcattacttta
ggtactaaagaaccataccgtatgtttacctcacgtgccgaatatcgtttgatgttgcgt
gaagacaatgcagatcaacgtttaacgactgttggtcgtgaactaggtttggttgatgat
gttcgttgggctgcttattgtgaaaaaatggaagcggttgagcgtgaaacttctcgttta
caacatttgtgggcggcaccaaataaccctatgggtaaaaaattcgttgagatgacaggt
gctgacttaagtaaagaatgtagtgcgattgatttgcttaaacgccctaatattaacttt
ggtcaaattgccgaacttacgggttctgaagtttctgaacaagttggtgagcaaatcgag
attgctgtgaaatacgaaggttatattaaccgtcagcatgaagatgtggcacagttaaag
cgtcttgaagaaactaaaattcctactgattttaattatgatgtagtgtctggtttatct
cgtgaaattacccagaaattaaaaacggttcttccagaaacattagctcaagcaagtcgt
attcctggtgttacaccggcagctgttcagcttgtaatgatcacaattcgtaaaaataat
atgattaagaaaacagcttaa

DBGET integrated database retrieval system