KEGG   Acinetobacter calcoaceticus: BUM88_13395Help
Entry
BUM88_13395       CDS       T05452                                 

Definition
(GenBank) superoxide dismutase [Fe]
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
acal  Acinetobacter calcoaceticus
Brite
Enzymes [BR:acal01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BUM88_13395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AQZ82529
UniProt: A0A0A8XCY3
LinkDB All DBs
Position
2761966..2762592
Genome map
AA seq 208 aa AA seqDB search
MTTITLPALPYGYDDLAPHISKETLEYHHDKHHNTYVVNLNNLIKGTDLEGKTLEEIIKA
TAGDASKAGIFNNAAQVWNHTFYWNSMKPNGGGKPTGAIAAKIEEAFGSYEKFAEEFAAA
ATTQFGSGWAWLVADEVNGKLSITKTSNADTPLAHGQIAVLTIDVWEHAYYIDFRNLRPK
YIATFLESLVNWDYANAKLAGQPAGVEK
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccattactttacctgcacttccatatggctatgatgatttagcgccacatatt
agtaaagaaactttagaataccatcacgataaacaccacaatacctatgttgttaactta
aacaacttaatcaaagggactgaccttgaaggtaaaactttagaagaaatcatcaaagca
actgctggtgatgcatctaaagctggtattttcaataacgctgctcaagtttggaaccat
acattctactggaattctatgaagccaaatggtggtggcaagcctactggcgcaatcgct
gctaaaattgaagaagcttttggtagctacgaaaaatttgcagaagaatttgctgctgct
gcaacaactcaattcggttcaggctgggcttggttagttgctgatgaagtaaacggtaaa
ttatctattactaaaacttctaatgcagacactccacttgcacatggtcaaattgctgta
ttaacaattgacgtatgggaacatgcttactacatcgatttccgtaacctacgtcctaaa
tacatcgcaactttcctagaaagccttgtgaactgggactatgcgaatgcaaaacttgca
ggtcaaccagctggtgtagagaaataa

DBGET integrated database retrieval system