KEGG   Acinetobacter calcoaceticus: BUM88_15565
Entry
BUM88_15565       CDS       T05452                                 

Definition
(GenBank) dihydrolipoyl dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
acal  Acinetobacter calcoaceticus
Pathway
acal00010  Glycolysis / Gluconeogenesis
acal00020  Citrate cycle (TCA cycle)
acal00260  Glycine, serine and threonine metabolism
acal00280  Valine, leucine and isoleucine degradation
acal00310  Lysine degradation
acal00380  Tryptophan metabolism
acal00620  Pyruvate metabolism
acal00630  Glyoxylate and dicarboxylate metabolism
acal00640  Propanoate metabolism
acal01100  Metabolic pathways
acal01110  Biosynthesis of secondary metabolites
acal01120  Microbial metabolism in diverse environments
acal01200  Carbon metabolism
Module
acal_M00009  Citrate cycle (TCA cycle, Krebs cycle)
acal_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
acal_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:acal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BUM88_15565
   00020 Citrate cycle (TCA cycle)
    BUM88_15565
   00620 Pyruvate metabolism
    BUM88_15565
   00630 Glyoxylate and dicarboxylate metabolism
    BUM88_15565
   00640 Propanoate metabolism
    BUM88_15565
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BUM88_15565
   00280 Valine, leucine and isoleucine degradation
    BUM88_15565
   00310 Lysine degradation
    BUM88_15565
   00380 Tryptophan metabolism
    BUM88_15565
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:acal04147]
    BUM88_15565
Enzymes [BR:acal01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     BUM88_15565
Exosome [BR:acal04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   BUM88_15565
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox GIDA AlaDh_PNT_C HI0933_like Pyr_redox_3 FAD_oxidored FAD_binding_2 NAD_binding_8 3HCDH_N DAO Thi4 FAD_binding_3 2-Hacid_dh_C Lycopene_cycl
Other DBs
NCBI-ProteinID: AQZ82908
LinkDB
Position
complement(3237391..3238824)
AA seq 477 aa
MSQQFDLVVIGGGPGGYEAAIRAAQLGFKVACIEKRIHNGKPSLGGTCLNVGCIPSKALL
DSSHRYEDTVHHLADHGITTGEVNFDLAKLLARKDKVVDQLTGGVDQLLKGNGIEWLKGT
GKLLAGKKVEFVSHEGETQVLEPKYVILASGSVPVNIPVAPVDQDIIVDSTGALNFQEVP
KRLGVIGAGVIGLELGSVWRRLGAEVVVFEAMDAFLPMADKALAKDYQKLLTKQGLDIRI
GAKVAGTEINGREVTVKYTQGGEEKTQTFDKLIVCVGRKAYAEGLLADDSGIKLTERGLV
EVNDYCATSVEGVYAIGDLVRGPMLAHKAMEEGVMAVERIHGHAAQVNYDTIISVIYTHP
EAAWVGLTEEQAKEKGHEVKTGQFGFAVNGRALAAGEGAGFVKFVADAKTDRLLGMHVIG
PAASDIVHQGMIALEFVSSVEDLQLMTFGHPTFSEVVHEAALAVDGRAIHAIQRKRK
NT seq 1434 nt   +upstreamnt  +downstreamnt
atgtctcaacaatttgatcttgttgttattggcggtggtcctggtggttatgaagctgca
attcgtgctgctcaactaggctttaaagtcgcttgtatcgaaaaacgtattcacaacggt
aagccatctttaggtggtacatgcttaaacgtaggttgtattccttctaaagcattactt
gattcttctcatcgttatgaagatacagtgcatcatttagctgatcacggtattactaca
ggtgaagtgaattttgatcttgctaagcttcttgctcgtaaagacaaagttgttgaccag
ttaactggcggtgtcgatcaattgcttaaaggcaatggtattgagtggttaaaaggtact
ggtaaattacttgctggtaaaaaagttgagtttgtttcacacgaaggtgagactcaagtt
ttagaacctaaatacgtgattcttgcgtctggttctgtgcctgtaaatattccagtagct
cctgtagatcaagatattattgttgattcaactggcgcattaaacttccaagaagtacct
aaacgtttaggtgttattggtgctggtgtaatcggtttagagcttggttctgtttggcgt
cgtcttggtgctgaagttgttgtatttgaagcaatggatgcatttttaccaatggctgat
aaagctttggcaaaagactaccaaaaacttttaactaagcaaggtcttgatattcgtatt
ggcgctaaagttgctggtactgagatcaatggtcgtgaagtgactgttaaatacacccaa
ggtggcgaagaaaaaactcaaacttttgacaaattaatcgtttgtgtaggccgtaaagct
tatgcagaaggtttattggcagatgattcaggcattaaattgactgaacgtggtttagtt
gaagtaaacgattactgtgcaacttctgtagaaggtgtatatgcaattggtgacttggtt
cgtggtccaatgcttgctcataaagcaatggaagaaggtgtaatggctgttgagcgtatt
cacggtcatgcagctcaagtgaactatgacacaatcatttctgttatctatacacatccg
gaagcggcatgggttggtttaactgaagaacaagctaaagaaaaaggtcatgaagttaaa
actggtcaattcggttttgctgtaaatggtcgtgctttagcagcgggtgagggtgctggt
ttcgttaagtttgttgctgatgcaaaaactgaccgtttattaggtatgcatgtcattgga
cctgctgcatctgatatcgtacaccaaggtatgatcgcacttgaatttgtatcttctgtt
gaagatcttcagttaatgacatttggtcatccaacattctctgaagttgttcatgaagct
gcacttgctgtagatggtcgtgcaattcacgcgattcaacgtaagcgtaaataa

DBGET integrated database retrieval system