KEGG   Acinetobacter calcoaceticus: BUM88_18850Help
Entry
BUM88_18850       CDS       T05452                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
acal  Acinetobacter calcoaceticus
Pathway
acal00473  D-Alanine metabolism
acal00550  Peptidoglycan biosynthesis
acal01100  Metabolic pathways
acal01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:acal00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BUM88_18850
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BUM88_18850
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BUM88_18850
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:acal01011]
    BUM88_18850
Enzymes [BR:acal01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BUM88_18850
Peptidoglycan biosynthesis and degradation proteins [BR:acal01011]
 Precursor biosynthesis
  Amino acid ligase
   BUM88_18850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp ATP-grasp_3 RimK ATPgrasp_YheCD GARS_A TTL
Motif
Other DBs
NCBI-ProteinID: AQZ83491
UniProt: A0A0A8XH50
LinkDB All DBs
Position
complement(3907311..3908237)
Genome map
AA seq 308 aa AA seqDB search
MSNATKFGKVAVLFGGKSAERAVSLDSGQAVLDALLRSGVQAEAFDPQDRSVTELVNYDR
AFIVLHGRGGEDGQIQGVLEWLNLPYTGTGVQGSAIGMDKVKTKQIWQGSDLPTAPYRII
TKETDLDAVIAELGLPVIIKPVHEGSSVGMSKVEKAEDFAAAIEKATQHDAVVMAEKWIT
GREFTISFLNGQPLPVIRLQPPADVAFYDYEAKYERNDVEYGIPCGLSETEEKNLQALCL
RAFQAVGAEGWGRIDAMQDEQGNFWLLEVNTVPGMTSHSLVPKAAQAVGYSFDELCVAIL
EQTLEGTA
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
gtgtcaaatgctacaaaattcggcaaagttgccgtgctatttggtgggaaatcggctgag
cgtgctgtgtctttagatagtggtcaggcagttctggatgctttgttacgctcaggtgtt
caggctgaagcatttgatccgcaagaccgcagtgtgactgaacttgtaaattatgatcgt
gcatttattgtattgcatggtcgtggcggtgaagatggccagattcaaggcgtacttgaa
tggttaaatctgccttatacaggaactggtgtgcaaggttctgctattggcatggataaa
gtcaaaaccaagcaaatctggcaaggtagcgatttacctacagcgccatatcgtattatc
actaaagaaacagatttagatgcggtgattgctgagttaggcttgcctgtcattatcaaa
cctgtacatgaaggctcaagcgtgggcatgagtaaggttgagaaagcagaagactttgct
gctgcaattgaaaaggcgactcagcacgatgctgttgtgatggcagaaaaatggatcaca
ggtcgtgaattcacaatctcgttcttaaatggacagcctttgccagttattcgtttacaa
ccaccagcagacgttgctttttatgactatgaagcaaaatatgaacgtaatgatgttgag
tacggcattccttgtggtctaagtgagacagaagagaaaaacctgcaagcattgtgctta
cgtgcttttcaagctgttggtgctgaaggctggggccgtattgatgcgatgcaggatgag
cagggtaatttctggcttttagaagtaaacactgtgccaggtatgaccagccactcttta
gttccaaaagctgctcaagctgttggctatagttttgatgaattgtgtgttgccattctt
gagcaaacattggaaggtacggcttaa

DBGET integrated database retrieval system