KEGG   Acanthamoeba castellanii: ACA1_048530Help
Entry
ACA1_048530       CDS       T02667                                 

Definition
(RefSeq) copper/zinc superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
acan  Acanthamoeba castellanii
Pathway
acan04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:acan00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    ACA1_048530
Enzymes [BR:acan01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     ACA1_048530
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 14911466
NCBI-ProteinID: XP_004333065
UniProt: L8GDC4
LinkDB All DBs
Position
Unknown
AA seq 157 aa AA seqDB search
MATKTAVCVLRGFGDAAVEGTVRFSQTADDEPTTIDVEIKGLKPGPHGFHVHEFGDNTNG
CVSAGGHFNPFGKKHGGPDDEERHVGDLGNVVADETGVARTTIKDRLVTLGGPHSIIGRT
MVVHADEDDFGKGGFEDSLTTGHAGARLACGVIGLSK
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccaagactgctgtgtgcgtgctgcgcgggttcggagatgcggctgtggagggc
actgtgcgcttttcgcagacggctgatgacgagccaacgacgatcgatgtcgagatcaag
ggcctcaagcccggcccccacggcttccacgtccacgagttcggcgacaacaccaacggc
tgcgtgagcgcgggcggccacttcaaccccttcggcaagaagcacggcggacccgacgat
gaggagcgtcatgttggcgacctcggcaacgtcgtggccgacgagacgggcgtggcccgc
accaccatcaaggacaggctcgtcaccctcggcggcccccactccatcatcggcaggacc
atggtcgttcacgccgatgaggatgactttggcaagggtggcttcgaggattcgctgacg
actggccacgctggtgctcggctggcgtgcggcgtcatcggcctctccaagtaa

DBGET integrated database retrieval system