KEGG   Acanthamoeba castellanii: ACA1_057530Help
Entry
ACA1_057530       CDS       T02667                                 

Definition
(RefSeq) phosphatase, putative
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
acan  Acanthamoeba castellanii
Pathway
acan00562  Inositol phosphate metabolism
acan01100  Metabolic pathways
acan04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:acan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    ACA1_057530
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    ACA1_057530
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:acan01009]
    ACA1_057530
Enzymes [BR:acan01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     ACA1_057530
    3.1.3.48  protein-tyrosine-phosphatase
     ACA1_057530
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     ACA1_057530
Protein phosphatases and associated proteins [BR:acan01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    ACA1_057530
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase3 PTPlike_phytase Y_phosphatase
Motif
Other DBs
NCBI-GeneID: 14918462
NCBI-ProteinID: XP_004339130
UniProt: L8GW34
LinkDB All DBs
Position
Unknown
AA seq 487 aa AA seqDB search
MQKLTNPMRKKVSLKKKRWVKDGFDLDLAYIGDSRLLAMGYPSEGAEGVYRNPLSEVQRF
LDNYHPNKYMVYNLCAERVYVSTKFNMRVRVFPFMDHNSPPLHQIPEMCYSLYLFLAQDP
EHVAAIHCKAGKGRTGLLICCYLLHCGRFSTAEEAMKYYGKERTRDGKGVTIPSQIRYIK
YYEQMLDAPFQPRFVDAPPLWIKGFILHGIPKGKKDIQVIIEEYGYNERFRSSIKQIGKQ
EKQIGMLNIDFHKPLRVVRDVHVVANSGKGTLFMFWFHTAFVKDGRLVLTKPELDKACRD
KKKVFSKDFQVEMYFMSEAEYEEEIKKGKFSLKDLKNAESGSSLPNGEENGASDSSSDKK
EPADGEEDGSSSSSDEEDDEDYSYAENGNGEVIDVEREKKANEDMSEDSDADEESEAEEG
KRPNLGVPGSFIKGVPRGNSSPRGNASGGLLQPFSPQKTNSGKNFLVGKARTDNTSGLGK
EPKETKE
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgcagaagctcacgaatccgatgagaaagaaggtctcgctcaagaagaagcgatgggtg
aaagacggattcgacctcgacttggcctacatcggcgacagtcgcctgctggccatgggc
tatccctcggagggcgctgaaggcgtgtaccgaaaccccctctctgaagtccagcggttc
ctcgacaactaccaccccaacaagtacatggtgtacaacctgtgcgccgagcgggtctac
gtctccaccaagttcaacatgcgagtgcgcgtgttcccgttcatggaccacaactcgccg
cctctgcatcagattcccgagatgtgctacagtctgtatctcttcctcgcacaagacccg
gagcacgtggccgcaattcattgtaaggccggcaagggtcgcacgggcctgctgatctgc
tgctacctgctgcactgcggccggttcagcacggccgaggaggccatgaaatactacggc
aaggagcgcacccgcgatggcaagggcgtcaccatcccctcgcagattcggtacatcaag
tactacgaacagatgctggacgcgcccttccagccgcggttcgtcgacgcgccaccgctg
tggatcaagggcttcatcctgcacggaatccccaagggcaagaaagatattcaggtgatc
atcgaggagtacggctacaacgagcgcttcaggtcttcgatcaagcagatcggcaagcag
gagaagcagatcggaatgctcaacatcgattttcacaagcctctgcgcgtcgtcagggac
gtccacgtcgtagccaactctggcaagggcacgctgttcatgttttggttccacacggcc
ttcgtgaaggacggccggctcgtgctcaccaagcccgagctcgacaaggcctgccgcgac
aagaagaaggtcttcagcaaggacttccaggtggagatgtactttatgtccgaggccgag
tacgaggaggagatcaagaagggcaagttctccctcaaggacctcaagaacgccgagtcc
ggctccagcctccccaacggcgaggagaacggcgcgtcggattcgtcgtccgataagaag
gagccggctgacggcgaggaggacggttcatcgtcctcgtccgatgaagaggacgacgag
gactacagttacgcggagaacgggaacggcgaagtcatcgatgttgagcgtgagaagaag
gccaacgaggacatgtccgaagactccgacgccgatgaggagagcgaggccgaggaggga
aagcggccaaaccttggcgttcccggttccttcatcaaaggagtgccgcgaggaaactct
tcgccgcgcggtaatgcgtcgggcggtctgttgcagcccttcagcccgcagaagaccaac
tcggggaagaatttcctggtgggcaaggccaggaccgacaacacgagcgggctgggcaag
gagcccaaggaaaccaaggaatga

DBGET integrated database retrieval system