KEGG   Acanthamoeba castellanii: ACA1_059840Help
Entry
ACA1_059840       CDS       T02667                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
acan  Acanthamoeba castellanii
Pathway
acan00620  Pyruvate metabolism
acan01100  Metabolic pathways
acan01200  Carbon metabolism
Module
acan_M00168  CAM (Crassulacean acid metabolism), dark
acan_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
Brite
KEGG Orthology (KO) [BR:acan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ACA1_059840
Enzymes [BR:acan01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     ACA1_059840
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2 DUF1635
Motif
Other DBs
NCBI-GeneID: 14917863
NCBI-ProteinID: XP_004339280
UniProt: L8GWF8
LinkDB All DBs
Position
Unknown
AA seq 916 aa AA seqDB search
MGDAIVNLGVPANPSAVPHAHTAFDDDLDLLDDLLHKTIKSMDEDGEKLNQLVKDVVGMA
KEWRSDPAHHSHTSFDDFIKSMKSKDALRLVRIISHYLNLANVADQHHIVRLMRKHQIEQ
TPLPYTFQQVFDTLIEAGVSTDDIYQALMEQKIEPVLTAHPTQVMRRTILSKNNKISEAL
ARRDFQQLTTEEKEEVFAALRREIGGAWLSDEIRRKRPTPDEEAMGGLAVIEQSLSLADS
DRSTGHAVPKLLRRLDWTVQKYTGKSLPPEFSNLTFGSWMGGDRDGNPNVTPEVTKRCCY
FSRWIAADLYYREVDALLFELSMIRCTKELTEEAALAAERRRRHGEKYLTTLYKEFREGI
PEKEAYRIVLAEVRDTFLVTKRRLEDMIMGKPISSESTYYTQTSEVLAPLCLCYRSLKET
GAGEIADGRLLDLIRRLSSFGLGLVKLDIRQESDRHTEVLDTITTYLGMGSYEEWDEEKR
VEFLRVKEVLETFKVAASLGPESLGAYVISMCRTASDILAVELLQKEAGNKHPQRVVPLF
ETVDDLRNSAPVMRRLFSNDWYRTHIKGRQEIMIGYSDSAKDAGRLTSAWELYKAQEALL
KLCEEFGVKLTLFHGRGGTVGRGGGPSYLAIQSQPPGTLAGRLRVTEQGEMIQSQFGLPG
IAYRTLEVYVTATLKTRFLPPVRPTPRWCEIMDRLSATACDAYRALIRGNPRFVEYFRAA
TPSGELSYLNIGSRPAKRNVQGGIESLRAIPWIFAWTQTRLLLPAWLGVGEALELAAQEG
LGEELKTMYAEWPFFQSTVDLVEMVLSKGDPEIAARYNEVLVPPELQEMGHQLVQKFNFT
ATHILSLTGHKVLQESNPLLLESINLRRGFVDPINLIQVEILRRMREGKDGQVDEVLLDA
FIITINGIAAGMRNTG
NT seq 2751 nt NT seq  +upstreamnt  +downstreamnt
atgggagatgcgatcgtgaatttgggggtgccggccaaccctagcgcagtgccccatgcc
cacacagcgttcgatgacgatctggacctcctcgacgacctcctccacaagaccatcaag
tctatggatgaagacggtgaaaagttgaaccagctggtgaaggacgtggtggggatggcc
aaggagtggcgcagcgaccctgcccaccacagccacacctccttcgacgacttcatcaag
agcatgaagtccaaggacgcgctgaggctggtgcgcatcatttcgcactacctcaacctg
gccaacgtggccgaccagcaccacatcgtgcgcctgatgcggaagcaccagatcgagcag
accccgctgccctacaccttccagcaggtcttcgataccctcatcgaggccggcgtcagc
actgacgatatttatcaggcgctgatggagcagaagatcgagccggtcctcaccgcgcat
ccgacgcaggtgatgcgccgcaccatcctctccaagaacaacaagatctcggaggcgctc
gcgcgcagggactttcagcagctcaccaccgaggagaaggaggaggtgttcgccgccttg
cgtcgcgagatcggcggagcgtggctgtccgacgagattcgccgcaagaggccgacgccg
gacgaggaggccatgggcggcctcgccgtcatcgagcagagcctctctttagctgacagc
gaccgctcgacagggcacgccgtgcccaagctgctgcgcaggctggactggacggtgcag
aagtacaccggcaagtccctcccgcccgagttcagtaacctcaccttcggctcctggatg
ggcggcgatcgcgacggcaaccccaacgtgacgcccgaggtgacgaagcgctgctgctac
ttctcccgctggattgctgccgatctctactatcgtgaggtggacgcgctgctgttcgag
ctgtcgatgatccgctgcaccaaggagctcacggaggaggccgcgctcgcggccgagcgt
cgccgccgccacggcgagaagtacctcaccaccctctacaaggagttccgcgagggcatc
cccgagaaggaggcctaccgtatcgtgctcgccgaagtccgcgacaccttcctcgtcacc
aagaggcgattggaggacatgatcatggggaagccgatcagctcggagagtacctactac
acgcagacctcggaggtgctcgcgccgctgtgcctgtgctatcgctcgctcaaggagacg
ggcgcgggcgagatcgccgacggccggctgctcgacctcatccgccggctgtcgagcttc
ggcctcggcctcgtcaagctcgacatccgccaggagtccgaccgccacaccgaagtgctc
gacaccatcacgacgtatctggggatggggtcgtacgaggagtgggacgaggagaagcgc
gtggagttcctgcgagtgaaggaggtcctggaaacatttaaggtggctgccagcctgggt
cccgaatcgctgggcgcttacgtgatctcgatgtgccgcaccgcgtcggacatcctcgcc
gtcgaactcctccagaaggaggccgggaacaagcacccgcagagggtggtgccgctgttc
gagacggtggacgatctccgcaactcggcgcccgtcatgcgtcggctgttctccaacgac
tggtaccggacccacatcaagggccgccaggagatcatgatcggctactccgactcagcc
aaggacgccggtcgcctcacctctgcgtgggagctgtacaaggcccaggaggccctgctc
aagctatgcgaggaattcggggtgaagctcaccctcttccacggccgcggcggcacggtc
ggtcgcggcggcggcccgtcgtacctcgccatccagtcccagccgccgggcaccctggcc
ggccgcctgcgtgtgaccgagcagggcgagatgatccagtcccagttcggcctgcccggc
atcgcctaccgcacgctcgaggtctacgtcacggccacgctcaagacccgcttcctcccg
cccgtcaggcccaccccgcgctggtgcgaaatcatggaccgcctctccgccaccgcctgc
gacgcctatcgcgccttgattcggggcaacccgcggttcgtggagtacttccgggcggcg
acgccgtcgggcgagctgtcgtacctgaacatcgggagccggccggccaagcggaacgtg
cagggcggcatcgagtcgctgcgggccatcccgtggatcttcgcctggacccagacccgc
ctgctgctgcccgcgtggctgggcgtcggcgaggccctcgagctggcggcccaggagggc
ctgggcgaggagctcaagaccatgtacgccgagtggcccttcttccagtccaccgtcgat
ctcgtcgagatggtcctctcgaagggagacccggagattgcggcgcggtacaacgaagtg
ttggtgccgccggagctgcaggagatgggccaccagctggtccagaagttcaacttcacc
gccacccacatcctctccttgaccggccacaaggtgctgcaggagtccaatccccttctg
ctcgagtcgatcaacctgcgtcgcggctttgtcgatcccatcaacttgatccaggtggag
atcctgcgccgaatgcgtgagggcaaggacgggcaggtggacgaggtcctgctcgacgcc
ttcatcatcaccatcaacggtatcgctgcgggcatgaggaacaccggctaa

DBGET integrated database retrieval system