KEGG   Acanthamoeba castellanii: ACA1_095580Help
Entry
ACA1_095580       CDS       T02667                                 

Definition
(RefSeq) serine/threonine kinase
  KO
K19584  protein kinase X [EC:2.7.11.11]
Organism
acan  Acanthamoeba castellanii
Brite
KEGG Orthology (KO) [BR:acan00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:acan01001]
    ACA1_095580
Enzymes [BR:acan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     ACA1_095580
Protein kinases [BR:acan01001]
 Serine/threonine kinases: AGC group
  PKA family
   ACA1_095580
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Seadorna_VP7 FTA2 Pkinase_fungal APH Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 14913251
NCBI-ProteinID: XP_004334921
UniProt: L8GJI9
LinkDB All DBs
Position
Unknown
AA seq 349 aa AA seqDB search
MHKVFGRSKTKDMSHKVLQKSLTHAEKLRSVRLNENPAMDDFEKVRTLGTGTFGRVYLVR
HKETGKFYALKVLRKMDVVRLKQVDHIKNEKNILLELNHPFIVTLYATWQDETNLYMLMD
YVIGGELFSYLRRAGRFANDTARMYAAMVVMALEHLHAKNILYRDLKPENLLIDKHGYLK
ICDFGFAKHVEDRTWTLCGTPEYLAPEIIQSKGHGKAVDWWALGVLLFEMLAGYPPFFDD
NPFGVYEKILAGRIHFPSHFDPDAKDLVRKLLAADRTQRLGNLKGGAEDVKNHPYFQSID
WQQLLEAKMRAPIVVRSKGEGDASNFETYDEIEDQPVSVDPFKFIFKDF
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgcacaaagtatttggaaggagcaagaccaaggacatgtcgcacaaggtgcttcagaag
tccctcacccatgccgagaagcttagatcggtgcgcctgaacgagaatcccgcaatggac
gactttgagaaagtgcgcaccctaggaacgggcacgttcgggcgggtgtacctggtgagg
cacaaagagacgggcaagttttacgcactcaaggtcctgcgcaagatggacgtggtgcgc
ctcaagcaggtagatcacatcaaaaacgaaaagaacattctactcgagctcaatcacccc
ttcatcgtcaccctctacgcgacgtggcaagatgagacgaatctgtacatgttgatggac
tacgtcatcggcggcgagctgttcagctacctgcgccgagcgggccgcttcgccaacgac
acggcgcgcatgtacgccgcgatggtggtgatggcgctcgagcacctccacgccaagaac
atcctctaccgcgacctcaagcccgagaacctgctcatagacaagcacggctacctcaag
atctgcgactttggcttcgccaagcacgtcgaggaccggacgtggaccctgtgcggcacg
cccgagtacctcgcgcccgagatcatccagagcaagggccacggcaaggccgtcgactgg
tgggcgctcggcgtgctcctgttcgagatgctcgccggctacccgcccttcttcgacgac
aacccgttcggcgtctacgagaagatcctcgccggccgcatccacttcccgagccacttt
gaccccgacgccaaggacctcgtgcggaagctgctcgccgccgaccgcacgcagcggctg
ggcaacctcaagggcggcgccgaagacgtcaagaaccacccctacttccagtccatcgac
tggcagcagctgctcgaggccaagatgcgggccccgatcgtcgtgcggtccaagggcgag
ggcgacgcctccaacttcgagacctacgacgaaatcgaagaccagcccgtcagcgtcgac
cccttcaagttcatcttcaaggacttctag

DBGET integrated database retrieval system