KEGG   Acanthamoeba castellanii: ACA1_138770Help
Entry
ACA1_138770       CDS       T02667                                 

Definition
(RefSeq) ammonium transporter subfamily protein
  KO
K06580  ammonium transporter Rh
Organism
acan  Acanthamoeba castellanii
Brite
KEGG Orthology (KO) [BR:acan00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:acan02000]
    ACA1_138770
   04090 CD molecules [BR:acan04090]
    ACA1_138770
Transporters [BR:acan02000]
 Solute Carrier Family (SLC)
  SLC42: Rh ammonium transporter
   ACA1_138770
CD molecules [BR:acan04090]
 Proteins
  ACA1_138770
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ammonium_transp 7tm_7 DinB_2 DUF4890
Motif
Other DBs
NCBI-GeneID: 14914776
NCBI-ProteinID: XP_004336213
UniProt: L8GMB4
LinkDB All DBs
Position
Unknown
AA seq 702 aa AA seqDB search
MSNEGTDHSDRSRSRSSGSRSRSRSAARAAVAQERDPHAQQPKPKPDPRRTDSRTRSSRS
RSSSRGRGRDSRSRSRSPYSDSRDSDRRPYRDDYSEGGSDYRARNRSDSDDGGDRKYTDE
AYTEEEDTSHFSDESSNDHYSYDEEEEEEARERDIDRVLFSEMPQPKMTDDKRTLEDDYA
FGLQENIKQLQGHILDIQKREVEKMSAYGNSLAPTAEPKKEESERKRFEQSLGDIREERK
KYRAMLYDAIKERDDLLESRQISKIEERIAKNRARRPPRHLHLHLRLHHRLHQLGADRVN
KYNGVDVTLLLMFFLQMGLTVLYIIFMDFTNDPAGKASQIYGWTDNVEYLYVFLIDIFMM
VFVGFTMQRAFLRKWGVLWHGWFAWETSGNPDGKIQLDTASLIHGLYCATTVLVAYGAVL
GRTNTLQTLVFTFLGGFFYCLNYYITVGEIHGTDLGGALTIHLFGAFFGIGVSFIIGLND
LNDFTIPGEFRVVINTALACCASGVTVVGLDWLFGPQKFRAHVLQHGVMAGGVVMGCAHS
ELVPAYVAIILGSLIAAPCTWVGLRYATPFMNKAHKLLPDVSIIPKDTAGVLFAHGVPGF
IGGLAGICATADYQDATQYGQTASDLFPNDPSSQAGRLTATWAVSMAIGLGAGALTGLLL
FVLRVLLPNEHVATKRRPAPAVGPRPFHDEVNWRELPLDVDE
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacgagggcaccgaccacagtgacagatcgcggagccgctcctccggctccagg
agccgttcgaggagcgccgcacgcgcagccgtagcccaggagcgcgacccgcacgcgcag
cagccgaagccgaagcccgacccccgccggacggattcgcgcacgcgcagcagccgcagc
cggagcagcagccgggggcgcggacgcgattcacggtcgcggtcgcggtcgccctacagc
gactcgcgcgactcggaccggagaccctacagagacgactacagcgagggcggcagcgac
taccgagcccgcaaccgaagcgactctgacgatggcggcgaccggaagtacaccgacgaa
gcctacacggaggaggaggacacttcgcacttctcggacgagtcgtcgaacgaccactac
agctacgatgaagaggaggaggaggaggccagggagcgggacatcgatcgggtcctcttc
tccgagatgccccagcccaagatgaccgacgacaagcgcaccctcgaggacgattacgcc
tttggccttcaggagaacatcaagcagctgcagggccacatcctggacatccagaagcga
gaggtggagaagatgagcgcctacggcaattccctggccccgaccgccgagcccaagaag
gaggaaagcgagaggaagaggtttgagcagtcgctgggcgacatccgggaggagaggaag
aagtaccgggcgatgctctacgacgccatcaaggagcgcgacgacctcctcgagagcagg
cagatctccaagatcgaggagaggatcgccaagaacagggcacgccggccccctcgtcat
cttcaccttcaccttcgccttcatcatcgccttcatcaactgggtgccgaccgcgtgaac
aaatacaatggtgtcgacgtgacgctgctgctcatgttcttcctgcagatgggcctcacc
gtgctctacatcatcttcatggactttaccaacgacccggccggcaaggcctcccagatc
tacgggtggaccgacaacgtggagtacctctacgtgttcctgatcgatatctttatgatg
gtgttcgtgggcttcaccatgcagagggccttcctgcgcaagtggggcgtgctgtggcac
gggtggttcgcgtgggagacgtcgggcaacccggacggcaagatccagctggacacggcg
agcctcatccacggcctctactgcgccacgacggtactggtggcctacggcgcggtcctg
ggccgcaccaacaccctccagacgctggtgttcaccttcctgggcggcttcttctactgc
ctcaactactacatcaccgtgggcgagatccacggcaccgacctcggcggcgcgctcacc
attcacctctttggcgccttctttggcatcggcgtctccttcatcatcggcctcaacgac
ctcaacgactttaccatccccggcgagttccgcgtcgtcatcaacaccgccctcgcctgc
tgcgccagcggcgtcacggtggtgggtctcgattggctgttcggcccgcagaagtttagg
gcccacgtgctgcagcacggcgtgatggccggcggcgtggtcatgggctgcgcgcactcc
gagttggtgcccgcctacgtggccatcatcctgggctccctcatcgccgccccctgcacc
tgggtcggcctcaggtatgcgacgccgttcatgaacaaggcccacaagctgctgcccgac
gtgagcatcatccccaaggacacggccggcgtcctgttcgcccacggcgtgcccggcttt
atcggaggcctcgccggcatctgcgccaccgccgactaccaagacgccacccagtatggc
cagaccgccagcgatctcttccccaacgacccgtcgtcccaggccggccgtctgacggcc
acgtgggccgtctccatggccatcggcctgggcgcgggagccttgacgggtctgctgctg
ttcgtgctgcgcgtgcttctgccgaacgagcacgtggccaccaagcgtcgtcctgctccg
gccgtgggcccccgtcccttccacgacgaggtcaactggcgcgagctgcccctcgacgtg
gacgagtaa

DBGET integrated database retrieval system