KEGG   Acanthamoeba castellanii: ACA1_165250Help
Entry
ACA1_165250       CDS       T02667                                 

Definition
(RefSeq) succinate dehydrogenase and fumarate reductase ironsulfur protein
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
acan  Acanthamoeba castellanii
Pathway
acan00020  Citrate cycle (TCA cycle)
acan00190  Oxidative phosphorylation
acan01100  Metabolic pathways
acan01110  Biosynthesis of secondary metabolites
acan01130  Biosynthesis of antibiotics
acan01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:acan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ACA1_165250
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    ACA1_165250
Enzymes [BR:acan01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     ACA1_165250
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_17 Fer4_10 Fer4_7 Fer2 Fer4_18 Fer4_9
Motif
Other DBs
NCBI-GeneID: 14925357
NCBI-ProteinID: XP_004354032
UniProt: L8HGP2
LinkDB All DBs
Position
Unknown
AA seq 294 aa AA seqDB search
MRRITARSVTTPLFTSKTASLAGSARPLFGIVSAADKVVPKDGLVTVEVYRWSADEKEKP
YIQSYKLDVNNCAPMVLDALLKIKNEQDPTLSFRRSCREGICGSCAMNIDGTNTLACLKP
VAESVTNGKIKIYPLPHLPVVRDLVPDLSNFYEQHKSIQPYLQVDDHAALGSSKTEQLQT
REDRKKLDGLYECILCACCSTSCPSYWWAGNENKYLGPAILLQAYRWIADSRDQHTNQRL
RALAKEDMKVYACHTIMNCTKVCPKGLNPALAVAKVKKATLELDVQQKKQALAH
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagaatcaccgctcgctctgtcactacgcccctcttcacatcgaagactgcttcg
ctcgccggctccgcccgccccctcttcggcatcgtttctgcggccgacaaggtcgttccc
aaggatggcctcgtgaccgtggaggtgtaccgctggtccgccgatgagaaggagaagccc
tacatccagagctacaagctggacgtcaacaactgcgcgcccatggtgctcgacgcgctg
ctcaagatcaagaacgagcaggaccccaccctctccttcaggaggtcgtgccgcgagggc
atctgcggcagctgcgcgatgaacatcgacggcaccaacacgctggcctgcctcaagccc
gtcgccgagtccgtcaccaacggcaagatcaagatctacccgctcccccaccttccggtg
gtgagggatctggtgccggacctgagcaacttctacgagcagcacaagtcgatccagccg
tacctgcaggtggacgaccacgccgccctgggctcgagcaagacggagcagctgcagacg
cgggaggacaggaagaagctcgacggcctctacgagtgcatcctgtgcgcgtgctgctcc
acgtcgtgcccctcctactggtgggccggcaacgagaacaagtacctcggccccgccatc
ctcctccaggcctacaggtggatcgccgactcccgcgaccagcacaccaaccagaggctc
agggctctggccaaggaggacatgaaggtgtacgcgtgtcacaccatcatgaactgtaca
aaggtgtgccccaaggggctcaacccggccctcgccgtcgccaaggtcaagaaggccacc
ctcgagctcgacgtgcagcagaagaagcaggccctcgcccactaa

DBGET integrated database retrieval system