KEGG   Acanthamoeba castellanii: ACA1_171710Help
Entry
ACA1_171710       CDS       T02667                                 

Definition
(RefSeq) ligase I, DNA, ATPdependent, putative
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
acan  Acanthamoeba castellanii
Pathway
acan03030  DNA replication
acan03410  Base excision repair
acan03420  Nucleotide excision repair
acan03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:acan00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    ACA1_171710
   03410 Base excision repair
    ACA1_171710
   03420 Nucleotide excision repair
    ACA1_171710
   03430 Mismatch repair
    ACA1_171710
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:acan03032]
    ACA1_171710
   03400 DNA repair and recombination proteins [BR:acan03400]
    ACA1_171710
Enzymes [BR:acan01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     ACA1_171710
    6.5.1.6  DNA ligase (ATP or NAD+)
     ACA1_171710
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     ACA1_171710
DNA replication proteins [BR:acan03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    ACA1_171710
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     ACA1_171710
DNA repair and recombination proteins [BR:acan03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     ACA1_171710
   NER (nucleotide excision repair)
    Other NER factors
     ACA1_171710
   MMR (mismatch excision repair)
    Other MMR factors
     ACA1_171710
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase DNA_ligase_OB_2 mRNA_cap_enzyme
Motif
Other DBs
NCBI-GeneID: 14925608
NCBI-ProteinID: XP_004356487
UniProt: L8HHC6
LinkDB All DBs
Position
Unknown
AA seq 753 aa AA seqDB search
MKEEAPEGEEPVGLQATEAEERAEAGSVENAAPEKEDVMDEQVKREGAEEEEEHNNLNEE
EEAEEEVDSDFDEKEEGVEEQPTIKTTIAKAAATKGKTVKGKSKEVTKGMLALLSSSVDY
DPVASAIWKKGEKVPYLWLARTFVEIEQYTARTEIIRLLTNMFRSVVELSPNDLLACVYL
TINKIAPSYEGLELGVGESILIKAVASATGKKDSVIKAEYEKLGDLGLVAAAARNTQKTM
FPPPPLTVSFVFNTLNQIAKAAGRASQDKKKGLIQQLLVGAREGEAQWLIRSLEGKLRIG
LAEKTVQVALAHAIVLTRTDLQDKRARLGLEERMRVAAETLKEVFNELPNYNILIPVILK
EEPEKWSESCHLTPGIPVHPMLAHPTKGIDEVLQRCADAAFTCEWKYDGERAQVHFTDDG
GVHVYSRNLEDNTTKYPDIKQNLPKAMKPDTHSFILDCEVVAYDREKKQILPFQVLSTRA
RKDADMSEIKVQICLFGFDLLYFNGQSLVREPFRKRRELLHNAFVEVDDEFKFARYSDAN
TTDEIANSLHESVAGNCEGLMIKRLDEDATYQPSKRSYSWLKVKKDYLTGMTDSVDLVPI
GAYYGKGKRTGVYGAFLLACYDPNAEEFQNVCKIGTGFSDEDLEKFAEFFKDKIISKPRP
YYRYSDQVEPDVWFDASVVWEVKAADLSLSPHYKAALGLVSESKGISLRFPRYLRTRDDK
KPEDATNGEQIAEMYQQQFANAPPANPRYGAPH
NT seq 2262 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaagaggctccagagggagaggagcccgtagggttgcaagcgactgaagcggag
gagagggccgaagcaggtagcgtcgagaacgcagcgcctgagaaggaagacgtcatggac
gagcaagtcaagagagaaggcgcagaagaggaggaagaacacaacaacctgaatgaagag
gaggaagccgaagaggaagtagactcagactttgatgaaaaggaagagggtgtggaggag
caacctaccatcaagaccacaatcgccaaggcagcagccacaaagggaaagaccgtcaag
gggaagtcgaaggaggtcacaaagggaatgctggcgctactgagttcctctgttgactac
gacccggttgcaagtgccatctggaagaagggggagaaagtcccctacctgtggctggcg
cgcacgtttgtagaaatcgagcagtatacggcacggacggagatcattcgactcctcacc
aacatgttcagatctgtcgtggagctctcgccgaacgatcttctcgcctgtgtctatctc
accatcaacaagatcgcgccgtcctacgagggactcgaactgggggtcggtgaatcgatc
ctcatcaaggccgtggcttcggcgaccggcaagaaggattccgtcatcaaggctgagtat
gagaagctgggtgatctgggactcgtcgcagctgctgcccgaaacacccaaaagaccatg
ttcccgccaccgcccctgacggtctcctttgtgttcaacaccctcaaccagatagccaag
gcggccgggcgcgcttcgcaagacaagaagaaagggctcattcagcagctgctcgtggga
gccagggagggagaggcgcaatggctcatccggtccctggaaggaaagctgcgcatcggt
ctcgcggagaagaccgttcaggtggcgctggcccacgccatcgtcctcacccgcactgat
ctccaagacaagcgagcgcggctgggcctcgaggaacgcatgcgtgtggccgccgaaacg
ttgaaggaagtattcaacgagctgcccaactacaacatcctcatccctgtcatcttgaag
gaggagccggagaagtggtccgaaagctgccatctcacgccaggcattcctgtccacccc
atgttggctcaccccacgaagggaatcgacgaagtgctgcaacgctgcgccgatgccgcg
ttcacctgcgagtggaagtacgacggggagcgagcgcaggtgcacttcaccgatgatggc
ggcgtccacgtgtacagcaggaacctggaagacaacaccaccaagtatcccgacatcaag
caaaacctgcccaaggccatgaagccggacacgcattcgttcattctggactgcgaagtg
gtggcctacgatcgggagaagaagcagatcctgcccttccaggtcttgtcgacccgtgcc
cggaaggacgcggacatgtctgagatcaaggtacagatctgcctgttcggcttcgatctg
ttgtatttcaacggccagtcccttgtacgcgagccattccgcaagaggcgggagctgctg
cacaatgctttcgtcgaggtggacgacgagttcaagtttgcccgttattctgatgcgaac
acgaccgatgaaatcgccaactccctgcacgaatcggtggccggcaactgcgagggtctc
atgatcaagcgcctggacgaggacgccacctaccagccctcgaagcgctcctattcgtgg
ctcaaggtgaagaaggactacctgaccggcatgaccgactcagtcgatctcgtccctatc
ggggcgtactatggcaagggcaagcgtacgggagtgtacggcgccttcctgctggcctgc
tacgaccccaacgccgaggaattccagaacgtctgcaagatcggcacgggcttctccgac
gaagacttggagaagtttgccgagttcttcaaggacaagatcatctccaagccccggccc
tactaccgctacagcgaccaagtcgagccggacgtctggtttgacgcaagtgtcgtgtgg
gaggtcaaggccgccgacttgtcgctcagcccgcactacaaagctgcgcttggactcgtt
tcggagagcaagggcatctcgcttcgcttccctcgataccttcgcacgagggacgacaaa
aagcccgaggacgccaccaacggtgaacagatcgccgagatgtaccagcagcagttcgcg
aacgcgccgccggccaaccctcgctacggcgctccccactaa

DBGET integrated database retrieval system