KEGG   Acanthamoeba castellanii: ACA1_172860Help
Entry
ACA1_172860       CDS       T02667                                 

Definition
(RefSeq) 20beta-hydroxysteroid dehydrogenase
  KO
K00079  carbonyl reductase 1 [EC:1.1.1.184 1.1.1.189 1.1.1.197]
Organism
acan  Acanthamoeba castellanii
Pathway
acan00590  Arachidonic acid metabolism
acan00790  Folate biosynthesis
acan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acan00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    ACA1_172860
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ACA1_172860
Enzymes [BR:acan01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.184  carbonyl reductase (NADPH)
     ACA1_172860
    1.1.1.189  prostaglandin-E2 9-reductase
     ACA1_172860
    1.1.1.197  15-hydroxyprostaglandin dehydrogenase (NADP+)
     ACA1_172860
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 KR Epimerase
Motif
Other DBs
NCBI-GeneID: 14925683
NCBI-ProteinID: XP_004356559
UniProt: L8HGK2
LinkDB All DBs
Position
Unknown
AA seq 283 aa AA seqDB search
MAAAQRTGAALVTGANKGIGFAIAAQLARARPDLHVLLGSRDWERGEEAVAKLKADGVHN
VRTLHVDLDDESSLHTAAVEVNSEFGGLDVLVNNAAVALKGNTFTESDARTTIDTNYHGT
RHVCSRFMPLLRDNGRVVNVTARMASLSKLTVPTLKAAFAKPDLTLEELDALMEKFVADV
TQGRYKEEGWPAGPGYPTAPYWVSKIGTNALTRVLARMEANNPNRSGVLVNACCPGFCRT
DLAGPKAPRSPEQGADVAVYLSLLPAEATFNGLLFGERKELSF
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggcagcggcacagagaacaggagcagcgctcgtgacgggagccaacaagggcatcggg
tttgccatcgctgctcaactcgcccgcgctcgccctgacctccacgtgctgttggggtcg
agggactgggagaggggtgaagaggcggtggccaagctcaaggccgacggggtccacaat
gtgcgcacgctgcatgtcgacctcgacgacgagtcgtctctccacactgcggccgtggag
gtcaacagcgagttcgggggcctggacgtgctggtcaacaacgcggccgtcgcactcaaa
ggcaacaccttcaccgagagcgatgccagaacaacgatagataccaactaccacggcaca
agacacgtatgctcacgattcatgccgttactgcgcgacaatggccgagttgtgaacgtc
accgcgagaatggcctcgctttccaagcttacggtgcccaccttgaaggcggccttcgcc
aagcctgacctgacccttgaggaactcgatgcgttgatggaaaagttcgtcgccgatgtg
acccaggggcgatacaaggaggagggctggcccgccggccccggctaccccaccgccccg
tattgggtgtccaagattggcaccaatgcgcttactcgcgtgctggcccgcatggaagcc
aacaatccgaataggtcgggtgtgttggtgaatgcgtgctgccccggcttttgtcgcacc
gacctggccggtcccaaggctcctcgctcacccgaacagggagccgacgtggccgtgtac
ctgtcgctgctgccggccgaggccaccttcaacggtctcctctttggcgagcgcaaggag
ctcagcttctag

DBGET integrated database retrieval system