KEGG   Acanthamoeba castellanii: ACA1_194910Help
Entry
ACA1_194910       CDS       T02667                                 

Definition
(RefSeq) alkaline phosphatase family subfamily protein
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
acan  Acanthamoeba castellanii
Pathway
acan00730  Thiamine metabolism
acan00790  Folate biosynthesis
acan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acan00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    ACA1_194910
   00790 Folate biosynthesis
    ACA1_194910
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:acan04147]
    ACA1_194910
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:acan00537]
    ACA1_194910
Enzymes [BR:acan01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     ACA1_194910
Exosome [BR:acan04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ACA1_194910
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:acan00537]
 Enzymes
  ACA1_194910
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme
Motif
Other DBs
NCBI-GeneID: 14921273
NCBI-ProteinID: XP_004367444
UniProt: L8H4F3
LinkDB All DBs
Position
Unknown
AA seq 575 aa AA seqDB search
MDSSRDFYTSTPGGSRDDEEFGTSGDDSFFTPLPWYALLPVNMWKKYKRALIIGVSVLGV
VLVGLIITAAVVSSRHDSSKHTATGPKNVIVMITDGFGPASVTLARTLNGAPLQLDRMIR
GTIRTKSANSLVTDSAAGATSYSCGLKTNNTFVAVDPRGRACGTILEAAQKKGMRTGLVV
TSRITDATPASFSSHSVTRYAQEFIASQQVTKGIDIMFGGGRDYYLPKSEGGLREDGKNL
LEEASKAGVSVATTLNQFNAISKMPTLGLFGMSHLDYTIDRNLEQPTLAQMVAKALSLLE
KDSPKGFFLMVEGSRIDHAGHDNDAATHYREVLAYDDALKEIITFAEKDGDTLVVSVSDH
ETGGLTLGVTPRSGSYPVYDWYWSPFPRYLEYTSFRLTNDWVQNKASAYKMAAAIHAAAP
NASEEQLLEAAKTVLREKAGLELNQEDLALLAPALSSKPTGIPLLNVIGNIIAYRAGIAW
TTLGHTGVDINLYSYTKAPNVDLPGVKITEKFGNGGNLENFDVGQYLIDVGHFDVEAVSR
ALQSFNPNPLAQEKTKRQMRKANVDVVVDPYHPEL
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atggacagttcgcgagatttctacacctccacccctgggggaagcagggatgacgaagag
tttggcaccagtggcgatgattccttcttcacgcctcttccgtggtatgctcttctgccc
gtcaacatgtggaagaaatacaagagggctctcatcatcggtgtgagcgttctcggggtg
gtgcttgtgggtctcatcatcaccgctgcggtcgtatcttcgaggcacgactcctccaag
cacactgccactggccccaagaatgtgatcgtcatgatcacggatggtttcggtccagca
tctgtcacgctggcccggacgctcaatggcgcaccactgcagctggaccgcatgatccgc
ggcactattcggaccaaatcggccaacagccttgtgaccgacagcgctgctggggcgacg
tcctacagctgcgggctgaagaccaacaacacctttgtggccgttgatccgagaggtcgt
gcttgtggtactatcttggaagctgcacagaagaagggaatgcggacgggtctagtcgtg
acgagtcgcatcacggatgccactcccgcctccttttcatcgcattctgtgactcgctat
gcgcaggagttcatcgcctcgcagcaggtaaccaaaggcatcgacattatgtttggcgga
ggtcgcgactactacttgccaaagagcgagggcggcttgcgagaggatgggaagaatctt
ctcgaggaagcctccaaggcgggcgtctctgtggccacgacgctcaatcagttcaacgca
atttccaagatgcccactctcggcctctttggcatgagccacctggactacaccatcgac
agaaatctcgaacagcccactctggctcaaatggtcgccaaggctctcagcttgctcgaa
aaagactccccaaagggatttttcctcatggtcgaaggttccaggatcgaccacgcaggg
catgacaacgatgctgccacccactatcgcgaggtgctggcgtacgacgacgctcttaag
gaaattatcacgtttgccgagaaggacggcgacaccctggtggtgagcgtatcggaccac
gaaaccggcggactcacgctgggcgtcactcctcgcagtgggtcctaccctgtctatgac
tggtactggagccctttccctcggtatctggagtacaccagttttcggctcacaaatgat
tgggttcaaaataaggcgtcagcctacaagatggcggcagcaatccacgccgcagcaccc
aatgcctccgaggaacaactgctcgaagcggcgaagactgttttgcgtgaaaaggccgga
ctcgagctcaaccaagaagatctggccttgcttgctcctgccctcagctccaagcccacg
ggcattcccctgttgaacgtgataggcaacattatcgcctaccgagccggcatcgcatgg
accactcttgggcacaccggggtggacatcaacctctactcctacacaaaagcccccaac
gttgacctcccaggagtcaagataacggaaaagttcggcaatggaggcaacttggaaaac
ttcgatgtgggccagtatctcattgatgtgggccactttgacgtcgaagccgtctctcgg
gcgctccagagcttcaaccccaacccactagcacaagagaagacgaagagacaaatgcgg
aaggccaacgtagacgtcgttgtcgacccgtaccaccccgagctgtga

DBGET integrated database retrieval system