KEGG   Acanthamoeba castellanii: ACA1_272580Help
Entry
ACA1_272580       CDS       T02667                                 

Definition
(RefSeq) acetylornithine deacetylase
  KO
K01438  acetylornithine deacetylase [EC:3.5.1.16]
Organism
acan  Acanthamoeba castellanii
Pathway
acan00220  Arginine biosynthesis
acan01100  Metabolic pathways
acan01110  Biosynthesis of secondary metabolites
acan01130  Biosynthesis of antibiotics
acan01210  2-Oxocarboxylic acid metabolism
acan01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:acan00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    ACA1_272580
Enzymes [BR:acan01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.16  acetylornithine deacetylase
     ACA1_272580
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-GeneID: 14925249
NCBI-ProteinID: XP_004353763
UniProt: L8HGF9
LinkDB All DBs
Position
Unknown
AA seq 451 aa AA seqDB search
MAAQLELDQTFFVELLGKLIGETYHLQNRPPDFIPQEDKAGRHVLSALEPYRVENGGVLR
IKHIHYAEHRGNIIIEYPAAKPAVAKDVSSVAFVGSHLDVVYANPETWERDPFKLTVEGD
KLYGRGSTDCLGHCALLTDLFKQLAETKPQLSVSVFGVLIVDEESGGRLPIGVDELMKHG
ELDAMKNGPLVWLDCADAQPNIGSGGLCQWELKVKGKLCHSGFPNKGVNALEMASDLIIQ
VQKKFYERFPPHEREEEYGFPCSSSLKPTQIAVPESGINQIPGECTVKGDIRLIPFYSIK
DAVKVVDDAVAQLREERFESLHQMAHRGPDARYVLKKREGDDEPAVFEWKWLCEPVQGIA
CHLDSLGFKSLAQATQEIIGEVKPLADTGTLPLVADLQAGGFDVQTVGYGDEEAYHADNE
FALLSSFVKGFKVLARIIDLVDSRASAQPQQ
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atggcagcacagttagaactcgatcagaccttcttcgtggagttgctggggaagctcatt
ggcgagacctaccatttgcagaaccggcctccggacttcattccgcaggaggacaaggcg
ggccggcatgtgctgagcgcgctggagccctaccgcgtggaaaacgggggcgttctgcgt
atcaagcacattcactacgccgagcaccgaggaaatatcatcatcgagtacccggcggcc
aagcctgcggtggccaaggatgtgtcgtcggtggccttcgtggggtcgcacctcgacgtg
gtgtacgccaacccggagacctgggagcgcgacccgttcaagctcaccgtggagggcgac
aagctctacggccgcggctccaccgactgcctgggccactgcgcgctcctcaccgatctc
ttcaagcagttggccgagacgaagccacagctgagcgtgagcgtgttcggggtgctgatc
gtcgacgaggaatcgggcggtcgtctgcccattggtgtcgacgagctgatgaagcacggc
gagctcgacgccatgaagaacggccctctggtctggctcgactgtgccgacgcccagccc
aacatcggcagcggtggtctctgccagtgggagctgaaggtgaagggcaagctttgccac
agcggcttccccaacaagggcgtcaacgccctggagatggccagcgacctcatcatccag
gtccagaagaagttctacgagcggttccctccgcacgagagggaggaggagtacggcttc
ccgtgctcgtcgtcgctcaagcccacgcagatcgcggtgccggagagcggcatcaaccag
atcccgggcgagtgcacggtcaagggcgacatccggttgattcccttctactccattaag
gacgcagtcaaggtggtcgacgacgccgtggctcagctgcgcgaggagaggttcgagtcg
ctgcaccagatggcccaccggggacccgacgcccgctacgtgctgaagaagcgcgaaggc
gacgacgagcccgccgtcttcgagtggaagtggctgtgcgaacccgtgcagggcatcgcc
tgccacctggacagcctcggcttcaagtccctcgcccaggccacccaggagatcatcggc
gaggtcaagcctctcgccgacaccggcacgctccctcttgtggcggacctccaggcaggc
ggctttgatgtgcagaccgttggttacggagacgaggaggcctaccacgccgataacgag
ttcgccctgctgtcgagcttcgtgaagggcttcaaggtgctcgcccggatcatcgacctc
gtcgacagccgggcctcggcccagccccagcagtag

DBGET integrated database retrieval system