KEGG   Acanthamoeba castellanii: ACA1_307500Help
Entry
ACA1_307500       CDS       T02667                                 

Definition
(RefSeq) alanine aminotransferase, mitochondrial, putative
  KO
K00814  alanine transaminase [EC:2.6.1.2]
Organism
acan  Acanthamoeba castellanii
Pathway
acan00220  Arginine biosynthesis
acan00250  Alanine, aspartate and glutamate metabolism
acan01100  Metabolic pathways
acan01200  Carbon metabolism
acan01210  2-Oxocarboxylic acid metabolism
acan01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:acan00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ACA1_307500
   00220 Arginine biosynthesis
    ACA1_307500
Enzymes [BR:acan01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     ACA1_307500
Amino acid related enzymes [BR:acan01007]
 Aminotransferase (transaminase)
  Class I
   ACA1_307500
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 14921132
NCBI-ProteinID: XP_004342401
UniProt: L8H524
LinkDB All DBs
Position
Unknown
AA seq 514 aa AA seqDB search
MSLPGRAASPSASLLLGTSRRPLSTAPSASAAPSGPIRGRLTTASMNQAVVGAAYAVRGE
LVMKADQYQRVLADPAQRDTLPFKEIIYCNIGNPQQLQQKPITFFRQVLSCMEYPALLDH
PAAAQIYPQDVLQRARHLLANFSGGTGAYSHSKGERIVREHVAGFLQKRDGYAAEPEDIY
LSDGASGSVSKALNILIHSRRDGVMIPIPQYPLYSATIPLLGGTQLNYYLDEENSWGLQV
SELESLVEDAHKKNVNPRALVIINPGNPTGQCLAESNMQEVIDFCRRRGIVLLADETNAY
TKPWLSFKKVLRDMGPKYKDVELISFHSVSKGVIGECGHRGGFMELVGIDEEVKQQFYKL
ASISLCPNLPGQVVVDLMVRPPVAGEPSYDLYHQETTGIFESLKRRALRLTEAFNKLEGV
TCNEAEGAMYLFPRVRLPAKAVHEAVKQKKTPDSFYCLALLDQTGICVVPGSGFGQKDGT
YHFRTTFLPPEDKIDAVAKSIAKFHHDFMQKYRD
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgtccctgccgggccgcgcggcttcgccgtcagcttcgctccttctcggcacgtcgcga
cgccccctctccaccgccccttcggcctcagccgccccctccggaccgattcgcggcagg
ctgaccacggcgtccatgaaccaggcggtggtcggggcggcgtacgccgtgcgcggcgag
ctggtgatgaaggccgaccagtaccagcgcgtcctggccgaccccgcccagcgtgacacc
ctccccttcaaggagatcatctactgcaacatcggcaacccgcagcagctgcagcagaag
ccgatcacgttcttccggcaggtgctgtcgtgcatggagtacccggcgctgctcgaccac
ccggcggcggcgcagatctacccgcaggacgtgctgcagcgcgcccggcacctgctcgcc
aacttctccggcggtaccggggcctactcccacagcaagggcgagcgcatcgtgcgcgag
cacgtcgccggcttcctccagaagcgcgacggctatgccgccgagcccgaggacatctac
ctgtcggacggcgcgtcgggttccgtgagcaaggccctcaacatcctcatccacagccga
cgtgatggagtcatgatccccatcccgcagtacccgctctactcggccaccattccgctg
ctgggcggcacccagctcaactactacctcgacgaggagaactcctggggcctccaggtt
tcggagctggagagcctggtggaggacgcgcacaagaagaacgtcaacccgcgcgccctg
gtgatcatcaacccgggcaaccccaccggccagtgcctcgccgaatccaacatgcaggag
gtcatcgacttctgccgcaggcgcggtatcgtcctcctcgccgacgagacgaacgcgtac
acgaagccgtggctgtcgttcaagaaggtgctgcgcgacatgggtcccaagtacaaggac
gtggagctcatctccttccactcggtctccaagggcgtcattggagagtgcggccaccgc
ggaggcttcatggagctggtgggcatcgacgaggaggtcaagcagcagttctacaagctc
gcttccatctccctctgccccaacctgccgggtcaggtggtggtggacctgatggtgcgg
cccccggtggcgggcgagccctcgtacgacctctaccaccaggagacgaccggcatcttt
gagtctctcaagaggcgcgccctccgtctcaccgaggccttcaacaagctcgagggcgtg
acgtgcaacgaagccgagggggcgatgtacctcttcccgcgcgtgcgcctgcccgccaag
gccgtgcacgaggccgtcaagcagaagaagacccccgactccttctactgcctcgccctc
ctcgaccagaccggcatctgcgtggtgccgggctccggctttgggcagaaggacggcacg
taccacttccgcactaccttcctcccgcccgaggacaagatcgacgccgtggccaagtcc
attgccaagttccaccacgacttcatgcagaagtaccgcgactaa

DBGET integrated database retrieval system