KEGG   Acanthamoeba castellanii: ACA1_382370Help
Entry
ACA1_382370       CDS       T02667                                 

Definition
(RefSeq) acid alphaglucosidase
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
acan  Acanthamoeba castellanii
Pathway
acan00052  Galactose metabolism
acan00500  Starch and sucrose metabolism
acan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    ACA1_382370
   00500 Starch and sucrose metabolism
    ACA1_382370
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:acan04147]
    ACA1_382370
Enzymes [BR:acan01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     ACA1_382370
Exosome [BR:acan04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ACA1_382370
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 Trefoil DUF5110
Motif
Other DBs
NCBI-GeneID: 14917483
NCBI-ProteinID: XP_004338781
UniProt: L8GVY3
LinkDB All DBs
Position
Unknown
AA seq 909 aa AA seqDB search
MKVSARTLVRFAGLLFIAAFAAASMVNVEDAQCLAGGVRKACALALISQSACEANGCCWA
PTAYDPTGTACPNGSGVPACFLPNPPVKGYRVIKRIDKDSGLEAYLQLVDGGYFYGKDLP
LLHLNVDFPTETQLRVTITDATEKRWEVPDIIETTPSSPVVSSSADYDFVLTHYPFAFAV
VRKSTGETLFNTSSPKWHLTQQQNNTEEGSGNEEFNGLVFEDQYLEISTQLPQDSFVYGL
GERAHPLRLNTSSAYYTFFAADNGGVPFLMNLYGSHPFYLEMRQKSKLTNLSQAHGVFLL
NSNGMDVYLGPSSLTYRAIGGVLDFFFMLGPSPADVIDQYTELIGRPHMCRYGYHNLSVV
ETVVAEYAKHKIPLDTMWNDIDYMNKYLDFTFDPVRYPVKDMQNFVNRLHDNGQQYIVIV
DAGIANVTSYPAYDQGLELDIFITRNATGTPLIGKVWPGFTAWTDYYHPNADRYWETQLK
GFLNTVPVDGIWVDMNEPSNFCDGECATPPMEPLGSLNTPPYAINNKGCTAPLNKNTISM
DANQHLSTHYNMHNLYGWSESRSTYRALRKLRQDKRPVIISRSTYPGHGRHAGHWLGDNA
STWTDLYMSIPGILNFQMFGIPLVGADICGFEQNTTPELCARWMELGAFYPFSRNHNALG
SISQEPYTWPEVAEISRNILAVRYSLLPYYYTLFYEFREDVTTWDIDRQFLIGSGLLISP
VLEANTSTVRAYFPAGKWYDFFTLAAIEGANTPTWLDLHTPLDKINVHIRGGLVLPLQAP
ALTTAETRKNNFHLVAALSAEGAAVGSLYQDSGDGYAFEERQQFTKTLYHVFNGPSGGYF
QANILENNYAGAAELMVETISVAGLSRRPTSVVLEGHTLPLGFDPYSGLLTVHGLQLSMA
QSWRLTWTY
NT seq 2730 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtctctgcgaggaccctcgtacgcttcgcaggccttctgttcatcgccgccttc
gctgccgctagcatggtcaacgtggaggacgcccagtgcctcgccggcggcgtgcgcaag
gcgtgcgctctggccctgattagtcagtcggcctgcgaggccaatggctgttgttgggcc
cccaccgcctacgaccccaccggcactgcctgccccaacggcagcggcgtcccggcctgc
ttcctccccaaccctcccgtcaaagggtaccgcgtgatcaagcggatcgacaaggacagc
ggtctggaggcctatctgcagttggtggacggtggctacttctacggaaaggatctgccg
ctcctgcacctcaatgtcgacttccccaccgagacgcagcttcgcgtgactatcaccgac
gcaactgagaagcgctgggaggtgccggacatcatcgagaccacgccgtcgtccccggtc
gtgtcctcctcggccgactacgattttgtgctcactcattacccgttcgcgttcgccgtg
gtgcgcaagtcgaccggcgagaccttgttcaacacctcctcgccgaaatggcacctgacc
caacaacaaaacaacactgaagagggcagcggcaacgaggagttcaacgggttggtgttc
gaggaccagtacctcgagatcagcacgcagcttccccaggattcgttcgtgtacggtctg
ggcgagcgcgctcatcctctgcggttgaacacctcctccgcctactacaccttctttgcc
gctgataacggcggagttccattcctgatgaacctctacggctctcaccccttctacctg
gagatgcgccagaagtccaagctcaccaatctgtcacaggcacacggcgtgttcctgctt
aacagcaacggcatggacgtctacctcggtccgtcgtccctcacctaccgcgccatcggt
ggcgtgcttgacttcttcttcatgctcggcccctcgcccgcggacgtgatcgaccagtac
accgaactgatcggccgccctcacatgtgccgttatggttaccacaacctcagcgtggtg
gaaaccgtcgtggccgaatacgccaagcacaagatccctctcgacaccatgtggaacgac
atcgattacatgaacaagtacctcgactttacgttcgaccccgtccgctatccggtcaag
gacatgcagaatttcgtgaaccgcctgcacgacaacggtcagcagtacatcgtgatcgtc
gacgccggcatcgccaacgtgaccagctatccggcctacgatcagggtctcgaactcgac
atcttcatcacgaggaacgccaccggtactcccctgatcggcaaggtgtggcccggcttc
acggcctggaccgactactaccaccccaacgccgaccggtactgggagacgcagctcaag
ggcttcctcaacaccgttcccgtcgatggcatttgggtggacatgaacgagcccagcaac
ttctgcgatggcgagtgcgcgacgcccccgatggagccgctgggatccctcaacacgcca
ccatacgcgatcaacaacaagggctgtaccgcgcccctcaacaagaacactatctccatg
gatgccaatcagcatctctccacccactacaacatgcacaacctctacggttggtccgag
tctcgctcgacctaccgtgcgctgcgtaagctgcggcaggacaagcggccggtcattatc
agccgctccacctaccccggccacggtcgtcacgccggccactggctgggcgacaacgcg
tcgacgtggacggacctctacatgtcgatccccggcatcctcaacttccagatgtttggc
attcctctcgtgggtgccgacatctgcggtttcgagcaaaacacgacgcccgagctgtgt
gcgaggtggatggagctgggcgcattctaccccttctctcgcaaccacaacgcgctgggc
agcatttcccaagagccctacacgtggcccgaggtcgccgagatcagccgcaacatcctg
gccgtccgctactcgctgctgccctactactacaccctcttctacgagttccgcgaggac
gtgacgacgtgggatatcgaccgtcagttcctcatcggctcgggcctcctcatctcgccc
gtgctcgaggccaacacctccaccgtccgcgcctacttccccgccggcaagtggtacgac
ttcttcacgctggctgcgatcgagggcgccaacaccccgacctggctcgaccttcacacc
ccgctcgacaagatcaacgtccacattcgtggcggactcgtactgccgcttcaggcgccg
gcgctcaccacggccgagacgcgcaagaacaacttccacctggtcgccgccctctccgcc
gagggcgcggcggtcggttccctctaccaggactcgggcgacggttacgcgttcgaagag
cgccagcagttcacgaagactctctaccacgtcttcaatggacccagtggcggttacttc
caggccaacattctggaaaacaattatgcgggtgcggccgagctgatggtggagaccatc
tccgtggccgggctcagccgcaggccgacctcggtggtgctcgagggtcacacgctgccg
ctgggcttcgacccctactcgggcctcctcaccgtccacggcctgcagctctccatggcc
cagtcgtggcggctcacctggacctactag

DBGET integrated database retrieval system