KEGG   Aeromonas caviae: VI35_05970Help
Entry
VI35_05970        CDS       T05190                                 

Definition
(GenBank) chemotaxis protein CheY
  KO
K03413  two-component system, chemotaxis family, chemotaxis protein CheY
Organism
acav  Aeromonas caviae
Pathway
acav02020  Two-component system
acav02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:acav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    VI35_05970
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    VI35_05970
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:acav02022]
    VI35_05970
   02035 Bacterial motility proteins [BR:acav02035]
    VI35_05970
Two-component system [BR:acav02022]
 CheA family
  CheA-CheYBV (chemotaxis)
   VI35_05970
Bacterial motility proteins [BR:acav02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    VI35_05970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg FleQ Glycos_transf_1 OpuAC
Motif
Other DBs
NCBI-ProteinID: ATP89939
UniProt: A0A3N6V5Q5
LinkDB All DBs
Position
1241036..1241419
Genome map
AA seq 127 aa AA seqDB search
MDKNMKILIVDDFSTMRRIIKNLLRDLGYNNTHEADDGNTALPMLKNGDFQFVVTDWNMP
GMQGIDLLKAIRLDDKLKHLPVLMVTAEAKREQIIEAAQAGVNGYIVKPFTAATLKEKLD
KIFERIG
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
ttggacaagaacatgaaaatcctcatcgtcgatgacttttcaacgatgcgccggattatc
aagaacttgctgcgtgacctgggatacaacaatacccatgaagcagacgatggcaacacg
gcattgccgatgctgaaaaatggcgacttccagttcgtggtcaccgactggaacatgccc
ggcatgcagggcatcgacctgctcaaggcgattcgcctcgacgacaagctcaagcacctg
ccggttctgatggtgactgccgaagccaaacgcgagcagatcatcgaagccgcccaggcc
ggggtcaatggctatatcgtcaagccgttcaccgctgccaccctcaaagagaagctcgac
aaaatctttgaacgtatcggctaa

DBGET integrated database retrieval system