KEGG   Aeromonas caviae: VI35_05985Help
Entry
VI35_05985        CDS       T05190                                 

Definition
(GenBank) chemotaxis response regulator protein-glutamate methylesterase
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
acav  Aeromonas caviae
Pathway
acav02020  Two-component system
acav02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:acav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    VI35_05985
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    VI35_05985
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:acav02022]
    VI35_05985
   02035 Bacterial motility proteins [BR:acav02035]
    VI35_05985
Enzymes [BR:acav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     VI35_05985
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     VI35_05985
Two-component system [BR:acav02022]
 CheA family
  CheA-CheYBV (chemotaxis)
   VI35_05985
Bacterial motility proteins [BR:acav02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    VI35_05985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest Response_reg
Motif
Other DBs
NCBI-ProteinID: ATP89942
LinkDB All DBs
Position
1244372..1245487
Genome map
AA seq 371 aa AA seqDB search
MAVKVLVVDDSSFFRRRVSEIINQDPLMTVIDTAQNGREAVDKAQQLRPDVITMDIEMPV
LDGISAVREIMAKCPTPILMFSSLTHEGAKATLDALDAGALDFLPKKFEDIARDKDEAVN
LLQQRVKEIARKRFLMATRPRAPEPAARPAVTGTLNRPLAERQPEPVRAAAAPAAFKRSG
KSYQLVAIGTSTGGPVALQNVLTKLPGDFPHPILLIQHMPATFTAAFAARLNGLCQIGVK
EAQDGDVLKPGQAYLAPGGKQMLLEGRGPGARLRIIDGNDKVNYKPCVDITFASAAKTYG
DKVLAIVLTGMGADGRDGARLLKEQGATIWAQDEASCVVYGMPQAVAKAGIASESLPLDR
VAQRILVELGR
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcaaggtattagtggtcgacgattcgagtttcttccgccgtcgggtcagcgaa
atcatcaatcaggatcccctgatgacggtgatcgacacggcccagaacgggcgggaggcg
gtagacaaggcgcagcagttgcggcccgacgtcattaccatggacattgaaatgccggtg
ctcgacggcatcagcgccgtgcgcgagatcatggccaagtgtccgacccccatcctgatg
ttctcttccctgacccacgagggagccaaggcaacactggatgcgctggatgcgggcgcc
ctcgattttctgcccaagaagtttgaagacatcgcccgggacaaggacgaagccgtcaac
ctgctgcagcagcgggtcaaggagatcgctcgcaagcgcttcctgatggcgacccggccc
cgcgcccccgagcctgccgcccggcccgccgtcacggggaccctgaatcgccccttggcc
gaacgccagcccgagcctgtgcgggcagcggcggctcccgccgcgttcaagcgcagcggc
aagagttaccagctggttgccatcggtacctccaccggcgggccggtggcactgcagaac
gtgctgaccaagctgccgggggatttccctcatcccattctgctgatccagcacatgccg
gccaccttcaccgctgcctttgccgcccgcctcaacgggctgtgccagataggggtcaag
gaggcgcaggacggcgacgtgctcaagccgggtcaggcctatcttgcccccggtggcaag
cagatgctgctggaagggcgcgggcccggtgcccgtcttcgcatcatcgatggcaatgac
aaggtcaactacaaaccctgtgtggacatcaccttcgcctccgccgccaagacctatggc
gacaaggtgctggccatcgtcctgacaggcatgggcgcggatggccgcgacggtgcccgt
ctgctcaaggagcagggggcgaccatctgggcgcaggatgaagcctcctgcgtggtttat
ggcatgccccaggccgttgccaaggcgggcatagcaagcgaatccctgccgctggatcgg
gtggcccagcgcattctggtcgagttgggtcgctga

DBGET integrated database retrieval system