KEGG   Aeromonas caviae: VI35_06080Help
Entry
VI35_06080        CDS       T05190                                 

Definition
(GenBank) superoxide dismutase [Fe]
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
acav  Aeromonas caviae
Brite
Enzymes [BR:acav01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     VI35_06080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ATP89954
LinkDB All DBs
Position
complement(1258425..1259009)
Genome map
AA seq 194 aa AA seqDB search
MAFELPALPYAINALEPHISQETLEYHHGKHHNTYVVNLNNLVPGTEFEGKSLEEIIKTS
TGGVFNNAAQIWNHTFYWHCLSPNGGGEPTGALADAITKAFGSFAEFKDAFTKSAIGNFG
SSWTWLVKKADGSLAIVNTSNAGCPLTDAGTTPLLTVDLWEHAYYIDFRNLRPKYMETFW
ALVNWEFVAKNLAA
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggctttcgaacttcccgctctgccctatgcaatcaatgctctggaaccgcacatctcc
caggaaaccctggaataccaccatggcaagcaccacaacacctacgtggtcaacctgaac
aacctggtgccgggtaccgagtttgaaggcaagtctctggaagagatcatcaagacctcc
actggtggcgtcttcaacaacgctgcccagatctggaaccacaccttctactggcactgc
ctctccccgaacggcggtggcgagcccactggcgccctggccgatgccatcaccaaggcc
ttcggctccttcgccgagttcaaggatgcgttcaccaagtctgccatcggcaacttcggc
tccagctggacctggctggtgaaaaaggctgacggctccctggccatcgtcaacacctcc
aacgccggttgcccgctgaccgacgccggtaccaccccgctgctgaccgtcgacctgtgg
gaacacgcctactacatcgatttccgcaacctgcgtccgaagtacatggaaaccttctgg
gccctggtcaactgggaattcgtggccaagaacctggctgcctga

DBGET integrated database retrieval system