KEGG   Aeromonas caviae: VI35_06285Help
Entry
VI35_06285        CDS       T05190                                 

Definition
(GenBank) hypothetical protein
Organism
acav  Aeromonas caviae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UPF0370
Motif
Other DBs
NCBI-ProteinID: ATP89990
UniProt: A0A2X4NLB7
LinkDB All DBs
Position
complement(1297096..1297242)
Genome map
AA seq 48 aa AA seqDB search
MSLWLWIGLPLLFLLGLFLNAIKDMKQLEKQLPKYKDKIREVKDDEDD
NT seq 147 nt NT seq  +upstreamnt  +downstreamnt
atgagcttgtggttatggataggcttgccgctgctgtttctgctcggcctgtttctcaac
gccatcaaggacatgaagcagctcgagaaacagctgcccaagtacaaggacaagatccgg
gaggtcaaggacgacgaggacgactga

DBGET integrated database retrieval system