KEGG   Aeromonas caviae: VI35_06290Help
Entry
VI35_06290        CDS       T05190                                 

Definition
(GenBank) peptidase M15
Organism
acav  Aeromonas caviae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VanY
Motif
Other DBs
NCBI-ProteinID: ATP92295
UniProt: A0A2K0LUL1
LinkDB All DBs
Position
complement(1297242..1297928)
Genome map
AA seq 228 aa AA seqDB search
MNQDQLLGLDESHLILVGRGPHRLTAATAAAFNDMQVAAAHAGFNLQAASSWRGFERQLA
IWNGKWRGERPLLDAHNQPLDALQLGETERLHAILHWSALPGTSRHHWGTDLDIYDPDCL
PAGTRLALEPWEYEAGGWFADLREWLDDHMNDFGFFLPYAKGEQPDQGVAYEPWHLSFAP
ESDGLALDPAALALCLERADIEGKECILAHLDEILARYVTPAHHERRF
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaggatcaactgcttgggctggatgagagccacctcatcctggtggggcgcggc
ccccatcgtctgaccgccgccaccgcggcggccttcaacgacatgcaggtggctgccgcc
catgccggtttcaacctgcaggcggcctccagctggcgcggcttcgagcgccagctcgcc
atctggaacggcaaatggcgcggggagcgccctctgctggatgcgcacaaccagcccctc
gatgccctgcaactgggcgagaccgaacgactgcacgccatcctgcactggagcgccctg
cccggcaccagccgccatcactggggcacggatctcgacatctacgatccggactgcctc
cccgccggcacccggctcgcgctggaaccctgggagtacgaggcgggcggctggtttgcc
gatttgcgcgaatggctggacgatcacatgaacgacttcggcttcttcctgccctatgca
aaaggggagcaaccggatcagggggtggcctacgagccctggcacctgagcttcgcgccc
gaatccgacgggctggccctggatccggcggcgctggcgctttgtctggaacgggcggat
attgaaggcaaggagtgcatcctggctcatctcgacgagatcctggcccgctatgtcacc
ccggcacaccacgaaaggagattctga

DBGET integrated database retrieval system