KEGG   Aeromonas caviae: VI35_06345Help
Entry
VI35_06345        CDS       T05190                                 

Definition
(GenBank) hypothetical protein
Organism
acav  Aeromonas caviae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TctB
Motif
Other DBs
NCBI-ProteinID: ATP89998
UniProt: A0A2K0LSU9
LinkDB All DBs
Position
1310264..1310566
Genome map
AA seq 100 aa AA seqDB search
MQGLVILCWGGFVALLSLYHFARPEVAYGFLVYGGVKVRQSWDPLLTPWLERGLWGCCLL
TLVVLVLARGRSRRQEDARHVNLFILLLILVACLLLYYRG
NT seq 303 nt NT seq  +upstreamnt  +downstreamnt
ttgcaggggctggtgatcctctgctggggcggctttgtcgccctgctctccctctatcac
ttcgcccggccagaggtggcttacggctttctggtctatgggggcgtcaaggtgcgccag
agctgggatcccctgctcaccccctggctggagcgcgggctctggggttgctgcctgctg
accctggtggtgctggtgctggcccgtggccgcagccgtcggcaggaagatgcccgccac
gtcaatctcttcatcctgctgctgatcctggtggcctgcctgctgctttactaccggggc
tga

DBGET integrated database retrieval system