KEGG   Aeromonas caviae: VI35_06525Help
Entry
VI35_06525        CDS       T05190                                 

Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
acav  Aeromonas caviae
Pathway
acav00520  Amino sugar and nucleotide sugar metabolism
acav01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    VI35_06525
Enzymes [BR:acav01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     VI35_06525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: ATP90024
UniProt: A0A125Y021
LinkDB All DBs
Position
complement(1350590..1351735)
Genome map
AA seq 381 aa AA seqDB search
MYALTNCTLYTGSCVLTGYGVVIDGDKIVAISRQAELPAGIEQIDLQGANLSAGFIDVQL
NGCGGVMFNGHITTDTLATMQAANLKSGTTSFLPTLITSPDADMKQAVAVTRDYMAAHPN
EVLGVHLEGPYTNLKRKGIHPAEQIRQPADEMIDFFCDNADAIAKITLAPERNKPEHIRR
LVEAGILVSAGHTAANYDQAMAGFDNGMRFATHLYNAMTPTLNGREPGVVGAIYDRKDVY
AGIIVDGHHVHWANVRLAHRMLGERLVLVTDATAAAGAPEGFEKFDFCGATVYFRDGQCV
DENGTLGGSALTMIEGVENLVKQVGLPLDEALRMATLYPARAIGWDSRLGSIQVGKIANL
TVFDQAFAVCGTVVNGHYTTQ
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgtacgctctgactaattgcactctctacaccggcagctgcgttctgaccggttatggc
gtggtcatcgatggcgacaagattgtcgccatctcccgccaggcagaactgcccgccggc
atcgagcagattgacctccagggcgccaacctcagcgccggcttcatcgacgtccagctc
aacggctgcggtggcgtcatgttcaacggtcacatcaccacggacaccctggccaccatg
caggcggccaacctgaaatccgggaccaccagcttcctgccgaccctgatcaccagcccg
gatgcggacatgaagcaggccgtcgctgtcacccgcgactacatggccgcccaccccaac
gaggtgcttggcgtccatctggaagggccctacaccaacctcaagcgcaaggggatccac
ccggccgaacagatccgccagcccgccgacgagatgatcgacttcttctgcgacaacgcg
gacgccatcgccaagatcaccctggcgccggagcgcaacaagcccgagcacatccgccgt
ctggtggaggccggcatcctggtctccgccggccacaccgccgccaactacgaccaggcc
atggcgggctttgacaacggcatgcgctttgccacccacctctacaacgccatgactccg
accctgaatggtcgcgagcccggcgtggtcggtgccatctacgatcgcaaggatgtctat
gcgggcatcatcgtcgacggccaccacgtacactgggccaacgtgcgcctggcgcacagg
atgctgggggagaggctggtgctggtcaccgatgccaccgcggcggcaggtgcaccggaa
ggctttgagaaatttgatttttgcggcgcaaccgtctatttccgcgatggtcagtgcgtc
gatgagaatggtacactcggcggctccgccctcaccatgatcgaaggggtggaaaatctg
gtcaaacaggtcggattgccgctcgacgaagcactgagaatggccaccctttaccccgct
cgcgccattggatgggactcgcgtctcggtagtatccaggtcggaaaaattgccaacctc
accgtctttgatcaggccttcgcggtctgcgggaccgtggttaacggacactacacaaca
cagtga

DBGET integrated database retrieval system