KEGG   Aeromonas caviae: VI35_06565Help
Entry
VI35_06565        CDS       T05190                                 

Definition
(GenBank) LexA regulated protein
Organism
acav  Aeromonas caviae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RHH_1 RHH_5 CopG_antitoxin DUF2610
Motif
Other DBs
NCBI-ProteinID: ATP90031
UniProt: A0A081LJN9
LinkDB All DBs
Position
complement(1360922..1361218)
Genome map
AA seq 98 aa AA seqDB search
MAKQQTDRTTLDLFATEKRPGRPKTNPLPRETQLKINKRNQLKRDRENGLKRVELKVEAE
LLERLNQLALQQNVSRAELIQSILKQQIESAHAAGIAI
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
atggccaaacagcaaactgatcgaacaacactggatctgttcgcaactgagaagcgcccc
ggcaggccaaagaccaatccactcccccgcgagacccagctcaagatcaacaagcgcaac
cagctcaagcgcgatcgtgagaacgggctgaaacgggtcgagttaaaggtggaagccgag
ttgctggagcgcctgaaccaacttgcgctgcaacagaacgtcagccgagccgagctgatc
caatctatcctgaagcaacagatcgagtctgctcatgcagcaggcatcgcaatctga

DBGET integrated database retrieval system