KEGG   Aeromonas caviae: VI35_07685Help
Entry
VI35_07685        CDS       T05190                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
acav  Aeromonas caviae
Pathway
acav00473  D-Alanine metabolism
acav01100  Metabolic pathways
acav01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:acav00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    VI35_07685 (alr)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    VI35_07685 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:acav01011]
    VI35_07685 (alr)
Enzymes [BR:acav01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     VI35_07685 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:acav01011]
 Precursor biosynthesis
  Racemase
   VI35_07685 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ATP90191
UniProt: A0A2X4NGZ2
LinkDB All DBs
Position
complement(1607654..1608880)
Genome map
AA seq 408 aa AA seqDB search
MHKKTLLATLIFGLLAGQAVAAPYLPLADDHRNGQEQTAANAWLEVDLGAFEHNIQTLKN
RLGDKGPQICAIMKADAYGHGIDLLVPSVVKAGIPCIGIASNEEARVAREKGFEGRLMRV
RAATPDEVEQALPYKLEELIGSLESAKGIADIAQRHHTNIPVHIGLNSAGMSRNGIDLRQ
DDAKADALAMLKLKGITPVGIMTHFPVEEKEDVKLGLAQFKLDYQWLIDAGKLDRSKLTI
HAANSFATLEVPEAYFDMVRPGGIIYGDTIPSYTEYKKVMAFKTQVASVNHYPAGNTVGY
DRTFTLKRDSLLANLPMGYSDGYRRAMSNKAYVLIHGQKAPVVGKTSMNTTMVDVTDIKG
IKPGDEVVLFGRQGDAEVKQSDLEEYNGALLADMYTVWGYTNPKKIKR
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgcacaagaaaacactgctcgcgaccctgatctttggcctgctggccggccaggcggtc
gccgccccctatctgccgctcgccgacgaccaccgcaacggtcaggaacagaccgccgcc
aacgcctggctggaagtggatctcggtgccttcgagcacaacatccagaccctgaagaat
cgcctcggtgacaagggcccgcagatctgcgccatcatgaaggcggacgcctacggtcac
ggcatcgacctgctggtcccttccgtggtcaaggcaggcatcccctgcatcggcatcgcc
agcaacgaagaagcacgtgttgcccgcgagaagggcttcgaaggtcgcctgatgcgggtg
cgtgccgccaccccggatgaagtggagcaggccctgccctacaagctggaagagctcatc
ggcagcctggagagcgccaaggggatcgccgacatcgcccagcgccatcacaccaacatc
ccggtgcacatcggcctgaactccgccggcatgagccgcaacggcatcgatctgcgccag
gacgatgccaaggccgatgccctggccatgctcaagctcaaggggatcaccccggtcggc
atcatgacccacttcccggtggaggagaaagaggacgtcaagctggggctggcccagttc
aagctggactaccagtggctcatcgacgccggcaagctggatcgcagcaagctcaccatc
cacgccgccaactccttcgcaaccctggaagtgccggaagcctattttgacatggtgcgc
ccgggcggcatcatctatggcgacaccattccctcctacaccgagtacaagaaggtgatg
gcgttcaagacccaggtcgcctccgtcaaccactacccggcgggcaacaccgtcggctat
gaccgcaccttcaccctcaagcgcgactccctgctggccaacctgccgatgggctactcc
gacggctaccgccgcgccatgagcaacaaggcctatgtgctgatccatggccagaaggcc
cccgtcgtgggcaagacttccatgaacaccaccatggtggacgtcaccgacatcaagggg
atcaaacccggtgacgaggtggtcctgttcggacgccaaggtgatgccgaggtgaaacaa
tccgatctggaggagtacaacggtgccctcttggcggacatgtacaccgtctggggctac
accaaccccaagaaaatcaagcgctaa

DBGET integrated database retrieval system