KEGG   Aeromonas caviae: VI35_10890Help
Entry
VI35_10890        CDS       T05190                                 

Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabA
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
acav  Aeromonas caviae
Pathway
acav00061  Fatty acid biosynthesis
acav01100  Metabolic pathways
acav01212  Fatty acid metabolism
Module
acav_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:acav00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    VI35_10890
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:acav01004]
    VI35_10890
Enzymes [BR:acav01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     VI35_10890
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     VI35_10890
Lipid biosynthesis proteins [BR:acav01004]
 Fatty acid synthase
  Component type
   VI35_10890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: ATP90677
UniProt: A0A3N6TY14
LinkDB All DBs
Position
2316795..2317355
Genome map
AA seq 186 aa AA seqDB search
MTLDNDTTDPRLSLCEQGKESFTREELLACSRGELFGEGNSQLPAPNMLMMDRIVKINDH
GGEHGKGEILAELDITPDLWFFDCHFPGDPVMPGCLGLDAMWQLVGFFLGWKGGPGKGRA
LGVGEVKFTGQILPTAKKVTYKITFKRVINRKLVMGIADGVVEVDGRPIYSATDLKVGLF
KDTTAF
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
gtgaccctagataacgacaccactgatccccgcctctccctgtgcgaacaaggcaaagag
tcctttacccgtgaagagctgcttgcctgcagccgtggcgaattatttggtgaaggtaac
agccagctgcccgcccccaacatgctgatgatggatcgcatcgtcaagatcaacgaccat
ggcggcgagcacggcaagggggaaatcctggctgaactcgatatcacgccggatctctgg
ttcttcgactgccacttccccggcgatcccgtcatgcccggctgcctgggcctggatgcc
atgtggcaactggtcggcttcttcctgggctggaaagggggtcctggcaaaggacgtgcg
ctgggtgtcggtgaagtcaagttcaccggccagatcctgccgacggccaagaaggtcacc
tacaagatcaccttcaagcgcgtcatcaaccgcaaactggtcatgggcattgccgatggc
gtcgtggaagtggatggtcgccccatctacagcgccaccgatctgaaagtgggcctgttc
aaagacaccaccgcattctga

DBGET integrated database retrieval system