KEGG   Aeromonas caviae: VI35_11745Help
Entry
VI35_11745        CDS       T05190                                 

Definition
(GenBank) anaerobic glycerol-3-phosphate dehydrogenase subunit A
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
acav  Aeromonas caviae
Pathway
acav00564  Glycerophospholipid metabolism
acav01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:acav00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    VI35_11745
Enzymes [BR:acav01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     VI35_11745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Fer2_BFD FAD_binding_2 FAD_binding_3 Thi4 Pyr_redox_2 DAO_C 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: ATP90795
LinkDB All DBs
Position
2500918..2502597
Genome map
AA seq 559 aa AA seqDB search
MKRITTQVVIIGGGATGAGIMRDCALRGIDCILLERDDIAAGTTGRNHGLLHSGARYAVT
DQESARECIQENRILKRIASHCVEDTGGLFITLPEDDIHFQNTFMDACALAGIDARQLDP
AEALRLEPNVNPALIGAIQVPDGTVDPFRLAAANVLDAKEHGARIFTHSKVLGLLRTQDR
VHGVKAINTRTGEAFEVECQEVINAAGIWGQQICEYADLGIRMFPAKGSLLIMDYRLNQL
VLNRCRKPADADILVPGDTISLIGTTSSRIDYHKIDQLTVEPEEVEVLLREGIKLAPIMA
RTRLLRAYAGVRPLVAVDGDESGRNISRGIVLLDHAERDGLKGFNTITGGKLMTYRLMAE
WATDLLAKKLGNSKPCRTAELSLPGSRDPEKVSAPGLSVPAEGSAQYRHGERVIAFFRDN
PKANALICECEMVTAGEIEYALRELDVDNLVDLRRRTRLGMGPCQGELCAYRAAGLMQEY
GKADGRQACVMLRQFLEERYKGTRPVLWGDALREAEFTYWIYEGLFGLGEWTAPHLVSEP
SFPLDASTANSTKERSHEI
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaatcaccacacaagtcgtcatcataggggggggcgccaccggcgccggcatc
atgcgcgattgcgcgctgcgcggcatcgactgcatcctgcttgagcgggacgacatcgcc
gccggcaccacgggccgcaaccatggcctactccactccggcgcccgctacgcggtgacg
gatcaggagtccgcccgcgaatgcattcaggagaaccgcatcctcaagcggatcgccagc
cactgcgtcgaggacaccggcggcctcttcatcaccctgccggaagatgacatccatttt
caaaataccttcatggacgcctgcgccctggcaggcatcgacgcccgccagctggatccc
gccgaggcgctgcgccttgaacccaacgtcaacccggcgctgatcggtgccatccaggtg
ccggacggcacggtcgaccccttccgtctggctgccgccaacgtgctggacgccaaggag
cacggcgcccgcatcttcacccacagcaaggtgctggggcttttgcgcacccaggatagg
gtgcacggggtcaaggccatcaacacccgcaccggcgaagcgttcgaggtggagtgccag
gaggtgatcaacgccgccggcatctggggccagcagatctgcgagtatgccgacctcggc
atccgcatgttccccgccaagggctcattgctcatcatggattaccgcctcaaccagctg
gtgctcaaccgctgccgcaaaccggcggacgcggacatcctggtgccgggcgataccatc
tccctcatcggcaccacgtcgagtcgcatcgattaccacaagattgaccagctcaccgtc
gagcccgaagaggtggaggtgctgctgcgcgaggggataaaactggcccccatcatggcc
cgcacccgattgctgcgcgcctacgccggcgttcgccccctggtggcggtggatggcgac
gagtccggccgcaacatcagccgcggcatcgtgctgctggatcacgccgaacgagatggc
ctcaagggtttcaacaccatcaccggcggcaagctgatgacctaccggctgatggccgaa
tgggccaccgacttgcttgccaaaaagcttggcaacagcaagccctgccgcaccgccgag
ctgagcctgcccggctcgcgggatccggagaaggtctccgcccccggtctctcggtaccc
gccgaaggctcggcccagtaccgccacggcgagcgggtcatcgcctttttccgcgacaac
cccaaggccaacgccctcatctgcgagtgcgagatggtgaccgcgggcgagattgaatac
gccctgcgggagctcgacgtggacaacctggtggacttgcgccgccgcacccgcctgggt
atgggcccctgtcagggggagctgtgcgcctatcgcgccgccggcctgatgcaggagtac
ggcaaggcggacggtcgtcaggcctgcgtcatgctgcgccagttcctggaggagcgctac
aagggtacccggccggtgctgtggggcgatgccctgcgggaagcggaatttacctactgg
atctacgaagggctgttcggccttggtgagtggacggccccccacttggtgagcgagccc
tccttcccgctcgatgccagcaccgccaattccaccaaggagcgcagccatgaaatttga

DBGET integrated database retrieval system