KEGG   Aeromonas caviae: VI35_12425Help
Entry
VI35_12425        CDS       T05190                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
acav  Aeromonas caviae
Brite
KEGG Orthology (KO) [BR:acav00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    VI35_12425
Enzymes [BR:acav01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     VI35_12425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like DAO FAD_oxidored Thi4 FAD_binding_3 NAD_binding_8 AlaDh_PNT_C K_oxygenase Glutaredoxin FMO-like FMN_bind NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: ATP90900
LinkDB All DBs
Position
2655480..2657066
Genome map
AA seq 528 aa AA seqDB search
MLDTNLKQQLNGYLQYIVNPIEISVSGNDSDKSAELLALASEIAEMSPKISLTDGRNARK
PSMSIAPQGQTPRVHFAGIPMGHEFTSLVLALLQSGGHPSKADPAVLEQVKNLKGEFHFE
TYISLSCHNCPDVVQALNLMSTLNPGITHTMIDGALFQDEVNERQIMAVPNVYLNGQPFS
QGRISLEEIVAKLDTGAAERKAQELSEKAPYDVLVVGGGPAGAAAAIYAARKGIRTAIVA
ERFGGQVMDTVGIENFISVPYTEGPKLAASLEQHVKQYGVEVITEQRAAAISKDGYVNVD
LASGATLKSRAVILATGARWRDLNVPGELEYRTKGVAYCPHCDGPFFKGKRVAVIGGGNS
GIEAAIDLAGIVEHVTVVEFADTLRADDVLQKKARSMGNIDIIMSARTTEVIGDGSKVVG
MDYEDRTTGEIKHLAVAGIFVQIGLVPNTEFLKGSEVALTRFGEIEIDTKGATSLPGVYA
AGDATTVPFKQIIISMGAGATAALGAFDYLIRNPAPEAQATQADAVTA
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgttagataccaacctcaaacaacaactcaacggttacttgcagtacatcgtcaatccc
atcgagatcagcgtgtccggcaatgacagcgacaaatccgccgaactcctggcattggcc
agcgagatcgccgagatgtcccccaaaatttccctgaccgatggtcgtaacgcccgcaag
ccttccatgagcatcgcgccccagggccagaccccgcgcgtgcactttgccggcattccc
atgggtcatgaattcacctccctggtgctcgccctgctgcaaagcggcggtcacccctcc
aaggccgatccggccgtgctggagcaggtgaagaacctcaagggcgagttccacttcgag
acctatatttccctctcctgccacaactgtccggacgtggtacaggccctgaacctgatg
tccaccctgaaccccggcatcacccacaccatgatcgacggagccctgttccaggatgag
gtgaacgagcgtcaaatcatggcggtcccgaacgtctacctgaacggtcagccgttcagc
cagggccgcatttcgctggaagagatcgtcgccaaactcgacaccggcgctgccgagcgc
aaggcgcaagaactgagtgaaaaagcgccttatgacgtgctggtggtgggcggtggcccg
gccggtgccgccgcggccatctatgccgcccgcaaaggcattcgcaccgccattgtcgcc
gaacgtttcggtggccaggtgatggacaccgtcggcatcgagaacttcatctccgtgccc
tacaccgagggccccaagctggcagccagcctggagcagcacgtcaagcagtacggcgtg
gaagtgatcaccgagcagcgtgccgccgccatcagcaaggatggttacgtcaacgtggat
ctcgcctccggcgccaccttgaagagccgcgccgtgatcctggcgaccggtgcccgctgg
cgcgacctgaacgtgcctggtgaactcgagtaccgtaccaagggtgtggcctactgcccg
cactgtgacggccccttcttcaagggcaagcgggttgcggtgatcgggggcggcaactcc
ggcatcgaggcggccatcgatctggccggcatcgtcgagcacgtcaccgtggtggagttc
gccgataccctgcgtgccgacgacgtgctgcagaagaaggcccgttccatgggcaacatt
gacatcatcatgagcgcccgcaccaccgaagtgatcggcgacggcagcaaggtggtgggc
atggactacgaagatcgcactaccggcgagatcaagcatctggcggtggccggcattttc
gtccagatcggtctggtgccgaacaccgagttcctcaaggggagcgaagtggccctgacc
cgctttggcgaaatcgagatcgacaccaagggtgccacctccctgcccggcgtctatgcc
gcaggggatgccaccacggtaccgttcaagcagatcatcatctccatgggggcaggtgcc
accgccgccctgggtgcgtttgattacctcattcgcaacccggcgccggaagcacaagct
acccaggccgatgccgtgaccgcctga

DBGET integrated database retrieval system