KEGG   Acinetobacter baumannii ATCC 17978: A1S_1357Help
Entry
A1S_1357          CDS       T00486                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
acb  Acinetobacter baumannii ATCC 17978
Pathway
acb00473  D-Alanine metabolism
acb01100  Metabolic pathways
acb01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:acb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    A1S_1357
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    A1S_1357
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:acb01011]
    A1S_1357
Enzymes [BR:acb01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     A1S_1357
Peptidoglycan biosynthesis and degradation proteins [BR:acb01011]
 Precursor biosynthesis
  Racemase
   A1S_1357
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C DUF4454
Motif
Other DBs
NCBI-ProteinID: ABO11785
LinkDB All DBs
Position
complement(1588796..1590088)
Genome map
AA seq 430 aa AA seqDB search
MKLKTNFSHLAYSCALVLFGSMQFAHAAPLLTSHITNEVSPAPTANAWIEVDTQAFEDNI
KRTNQLLNGKTQLCVVMKANAYGHSIDLLMPSVMKLNVSCIGITSNAEAAMVRKHGYKGK
ITRLRTATDSEIINAHALNIEELLGNYDQATRISKWAEANNTTVHYSLALNSGGMDRNGL
EMSTAQGKEQAVAITKLPNLKIDGIMTHYAVEDEKYVRERLAQFNEQTAWLIKKAKLNRK
ELTLHTANSFATVNVPESHLDMVRAGAIIYGDFPNHPEYKRMMAFKTQIAAVNNYLKGST
VGYDQTYTLTRDSKLANLPVGYSDGYRRSFSNKAFVLVNGQKAPVVGRVSMNTVMVDVTD
IPEAKAGDEVVLFGRQGNAEVQSSDLTSLTGHILTEAYTPWSNSNPQVIKPIQSPQQVIL
TNSKVAATAE
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttaaaacaaatttttcgcatctcgcttatagttgtgcattggtattattcggt
tccatgcaatttgcccatgctgcacctttactcacgtctcatatcacaaatgaagtcagc
cctgcacctacagcaaatgcatggattgaagttgatactcaagcttttgaagataatatt
aaaaggacaaatcaattacttaatggcaaaacacaactttgtgtagtcatgaaagcaaat
gcatatgggcatagtattgacctacttatgccgagtgttatgaagttaaacgtatcgtgt
attggcatcaccagtaatgcagaagcggcgatggtgcgtaagcatggctataaaggtaaa
attacacgtttacgtacagccacagatagtgaaatcatcaatgcacatgcgttaaatatc
gaagagcttttgggtaattatgatcaggctacccgtatctctaaatgggcagaagcgaac
aatacaactgttcattatagcttggctttaaattcgggtggtatggatcgtaatggtctt
gaaatgtctacagctcaaggtaaagaacaagctgttgcaatcactaagcttccaaatctt
aaaattgatggcattatgacccattatgctgtagaagatgaaaaatatgttcgtgagcgc
ctagctcaatttaatgaacaaacagcatggttgattaaaaaagccaaactaaatcgtaaa
gaattaacattacatacagcaaattcatttgctaccgtaaatgttcctgaatcacattta
gatatggtccgtgcaggcgcaattatttatggagattttcctaatcacccagaatataaa
cgcatgatggcatttaaaacacaaattgctgcagttaataattaccttaaaggttcaact
gtaggttatgaccaaacttatacgttgacacgtgactccaaacttgcaaacctgcctgtc
ggttattcggatggctaccgtcgtagttttagtaataaagcttttgtcttagtcaatgga
caaaaagcgccagtggttggtcgagtatcaatgaatactgttatggttgatgtaacagat
attccagaagccaaagcgggtgatgaagttgtattatttggacgtcaaggcaatgctgag
gttcaatctagtgatttaacgagtcttacaggccatattttgacagaggcctatactcca
tggagtaactctaatccacaagtgattaaacctattcaatctccacaacaagtgatatta
accaatagtaaagttgcagcaaccgctgagtaa

DBGET integrated database retrieval system