KEGG   Acinetobacter baumannii ATCC 17978: A1S_1701
Entry
A1S_1701          CDS       T00486                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
acb  Acinetobacter baumannii ATCC 17978
Pathway
acb00010  Glycolysis / Gluconeogenesis
acb00020  Citrate cycle (TCA cycle)
acb00620  Pyruvate metabolism
acb01100  Metabolic pathways
acb01110  Biosynthesis of secondary metabolites
acb01120  Microbial metabolism in diverse environments
acb01200  Carbon metabolism
Module
acb_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:acb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A1S_1701
   00020 Citrate cycle (TCA cycle)
    A1S_1701
   00620 Pyruvate metabolism
    A1S_1701
Enzymes [BR:acb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     A1S_1701
SSDB
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2
Other DBs
NCBI-ProteinID: ABO12128
LinkDB
Position
1978428..1979918
AA seq 496 aa
MEEGTIAQWLIKEGDSFNKGDEICEIETTKIVNVLEAPFAGTLRKILAKDGDTLPVGGLI
AVCADSEVSDAEIEKFIASLGGSAAQAPEAPSEQSKAETSAPVAEKTEQPQTVAASASAP
AKVAKEDYAVPESLQGYQTSNELFATPHALKLAEKHNVNLAKVTGSGREGRISVQDIQKA
VQAAGGQWPDVKQQTQAKVVKSTADDSQVLATPVARRLAKQWGINLNDCRVSGTRGRVCK
EDVEAVYYRNNPTSVNEQPVQCAAQPQSTVTTVAMNGMRKAIASRLQAAKRNAPHFRLVV
DLNVEALQKLRKQINETVPQVKLSINDMLIKAAAAALIKVPEVNVQFDEATQSILQFSQA
DISVAVAIPNGLITPIVKAANQKSLAQISDDMRDLATRAKTGKLQPDEFQGGSFSISNLG
MLGIKQFDAIINPPQGAIMALGASESRAVVENGNVVVREIVTATLSCDHRVIDGAVGAKF
LASFKQFVENPALILV
NT seq 1491 nt   +upstreamnt  +downstreamnt
atggaagaaggcacgatcgcccaatggttgattaaagagggtgatagctttaataaaggc
gatgaaatttgtgaaattgaaaccacaaaaatcgtcaatgtgttagaagcgccttttgct
ggaacgctccgtaaaattttagcgaaagatggtgatactttacctgttggtggtcttatt
gccgtatgtgctgatagtgaagtttctgatgcagaaattgaaaagtttattgcatcacta
ggtggttcagcagctcaagccccggaagcaccttcggagcaaagtaaagcggaaacatct
gcacctgttgctgaaaaaacagaacaaccacagactgtagcagctagtgcttcagctcct
gcaaaggtagcgaaagaggactacgctgtaccagagtcattacaaggctatcaaacatct
aatgagttgtttgcaacaccgcatgccttgaagcttgcagaaaaacacaatgtaaacttg
gcaaaagtcacaggttctggtcgtgaaggacgtattagtgttcaagacatccagaaagct
gtacaagctgctggtggtcaatggcctgatgttaagcagcaaactcaagctaaagtggtt
aaatctacggccgatgatagccaagttttagcgacgcctgtagcacgtcgtttagcaaag
cagtggggcattaacctaaatgactgtcgtgtttcaggtactcgtggccgtgtctgtaaa
gaagatgttgaggcagtttactatcgtaataacccaacatcggtaaatgaacaacctgta
caatgtgcagcccaaccacaatcaaccgttacgacggtggcgatgaatgggatgcgtaaa
gcgattgcttcacggttacaggctgcaaaacgtaacgcaccgcatttccgtttagtggtc
gatctcaacgtagaagctttgcaaaaactacgtaagcagattaatgagactgttccacaa
gtcaaactttctattaatgacatgctaattaaggcagctgccgccgcactgattaaagta
cctgaggtgaatgttcaatttgatgaggcgacccaatcaattttacagttctctcaagcg
gatatttcggtggccgtagcgattccaaacggtttaattacacccattgtaaaagcagca
aatcagaagtctttagcacaaatttccgatgacatgcgtgatttggcaacgcgtgctaag
actggcaagttacaacctgacgagtttcagggaggcagctttagcatttcaaatttagga
atgttaggcattaaacagttcgatgccattatcaacccaccgcaaggtgcaattatggca
ttaggtgcttcggaatctcgcgctgttgttgaaaatggcaatgtagtggttcgtgagatt
gtcacagcgacgttgtcatgcgatcaccgagttattgatggcgcagttggggcgaaattc
ttggccagctttaagcagtttgttgaaaaccctgctttaattttggtgtag

DBGET integrated database retrieval system