KEGG   Acinetobacter baumannii ATCC 17978: A1S_2713Help
Entry
A1S_2713          CDS       T00486                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
acb  Acinetobacter baumannii ATCC 17978
Pathway
acb00020  Citrate cycle (TCA cycle)
acb00190  Oxidative phosphorylation
acb00650  Butanoate metabolism
acb01100  Metabolic pathways
acb01110  Biosynthesis of secondary metabolites
acb01120  Microbial metabolism in diverse environments
acb01130  Biosynthesis of antibiotics
acb01200  Carbon metabolism
Module
acb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
acb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
acb_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:acb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A1S_2713
   00650 Butanoate metabolism
    A1S_2713
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    A1S_2713
Enzymes [BR:acb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     A1S_2713
    1.3.5.4  fumarate reductase (quinol)
     A1S_2713
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C DAO Thi4 Pyr_redox_2 GIDA HI0933_like FAD_binding_3 NAD_binding_8 Pyr_redox_3 NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: ABO13126
LinkDB All DBs
Position
3145600..3147435
Genome map
AA seq 611 aa AA seqDB search
MGAINPKEDYSNIQNLTFDAVIVGGGGSGMRASYQLAQAGLKVAVLTKVFPTRSHTVAAQ
GGIGASLGNMQEDNWHFHFYDTVKGSDWLGDQDAIEFMCREAPKVVYELEHLGMPFDRNA
DGTIYQRPFGGHSANYGDKPVPRACAAADRTGHALLHTLYQSNVKMGTQFFVEWIALDLI
RNEAGDVLGVTAIDQETGNIAVFQAKATLFATGGAGRVYRASTNAYINTGDGLGMAARAG
IPLQDMEFWQFHPTGVAGAGVLLTEGCRGEGAILRNKDGEPFMERYAPTLKDLAPRDFVS
RSMDQEIKEGRGCGPKGDYILLDMTHLGADTIMKRLPSVFEIGKKFANVDITKEPIPVVP
TIHYQMGGIPTNMHGQVCLPEPGTDNYTKPVKGFYAIGECSCVSVHGANRLGTNSLLDLV
VFGKAAGEHIIDYVTKHHGDEYAPLPTNVLEQTLARVRKLDESTSGENAQEVADAIRDIV
QDHAGVFRTQALLDKGVKEILALEPRVRNIHLKDKSKVFNTARVEALEVENLYEVAKATL
ISAAARKECRGAHTVVDYELPADHPTYSYGRRDDEWMKHTLWYSSDNRLEYKPVRFKPLT
VDPIPPAPRTF
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcgataaaccctaaagaagattattcaaatattcaaaacctcactttcgatgct
gttatcgttggtggtggtggttctggtatgcgtgcatcttaccaacttgctcaagcaggt
ttgaaagttgcagtacttactaaagttttcccaacacgttcacatacagttgctgctcag
ggcggtattggtgcgtcgttaggtaacatgcaagaagataactggcatttccacttttac
gatacagtaaaaggttctgactggttaggtgaccaagacgcaatcgaatttatgtgtcgt
gaggcgccaaaagttgtttatgaacttgaacacttaggtatgccgtttgaccgtaacgct
gatggtacaatttaccaacgtccattcggtggtcactctgcaaactatggtgataaacca
gttccacgtgcttgtgctgctgccgaccgtactggtcacgctttattgcacacgctttat
caaagcaacgtgaaaatgggtactcaattcttcgttgagtggatcgctcttgatttgatc
cgtaacgaagcaggtgatgtactcggtgtaactgcaattgaccaagaaactggtaacatt
gcagtattccaagcaaaagcaacattatttgcaactggtggtgctggtcgtgtttaccgt
gcatcgacaaatgcttatatcaacactggtgacggtcttggtatggctgctcgtgctggt
attccattacaagatatggaattctggcaattccaccctacaggtgttgcgggcgcaggc
gtattgttgactgaaggttgtcgtggtgaaggtgcgatccttcgtaacaaagacggcgaa
ccattcatggaacgttatgcaccaactttaaaagacttggctccgcgtgacttcgtatca
cgttctatggaccaagaaattaaagaaggtcgtggttgtggtccaaaaggtgattatatc
ttgcttgatatgactcacttgggtgctgacacaattatgaagcgtttaccatctgtattt
gagattggtaaaaaattcgcaaacgttgacatcactaaagaaccaattccagtagtacca
acaatccattatcaaatgggtggtattcctacgaatatgcatggtcaagtgtgcttacca
gagcctggtacagacaactacactaaacctgtaaaaggtttctatgcaatcggtgagtgt
tcatgcgtatcagtacatggtgcgaaccgtttaggtactaactcacttcttgacttggtt
gtatttggtaaggctgctggtgagcacattatcgattacgtaactaaacatcatggtgat
gaatatgcaccgcttccaacaaatgtattagagcaaactttagctcgtgtacgtaaattg
gatgaatcaacttctggcgaaaatgctcaagaagttgctgatgcaattcgtgatatcgtt
caagaccacgcaggtgtattccgtactcaagcattgcttgataagggtgttaaagagatt
cttgctcttgaaccacgcgtgcgtaacattcacttgaaagataaatctaaagtatttaac
actgcacgtgttgaagcgcttgaagttgaaaacttatatgaagttgcaaaagctacatta
atttcagctgctgcgcgtaaagaatgtcgtggtgcgcatacggtagttgattatgaatta
ccagctgatcacccaacttattcatacggtcgccgtgatgatgagtggatgaaacatact
ttatggtattcatcagataaccgtttggaatataagccagtgcgctttaagccgttaact
gttgatccaattccaccagcaccacgtacattctaa

DBGET integrated database retrieval system