KEGG   Acinetobacter baumannii ATCC 17978: A1S_2714Help
Entry
A1S_2714          CDS       T00486                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
acb  Acinetobacter baumannii ATCC 17978
Pathway
acb00020  Citrate cycle (TCA cycle)
acb00190  Oxidative phosphorylation
acb00650  Butanoate metabolism
acb01100  Metabolic pathways
acb01110  Biosynthesis of secondary metabolites
acb01120  Microbial metabolism in diverse environments
acb01130  Biosynthesis of antibiotics
acb01200  Carbon metabolism
Module
acb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
acb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
acb_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:acb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A1S_2714
   00650 Butanoate metabolism
    A1S_2714
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    A1S_2714
Enzymes [BR:acb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     A1S_2714
    1.3.5.4  fumarate reductase (quinol)
     A1S_2714
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_9 Fer4_7 Fer4_18 Fer4 Fer4_6
Motif
Other DBs
NCBI-ProteinID: ABO13127
LinkDB All DBs
Position
3147450..3148160
Genome map
AA seq 236 aa AA seqDB search
MSRGTRTFEIYRYDPDKDKAPYMQTFKLELTDKHRMLLDALLALKVQDETLTFRRSCREG
ICGSDGVNINGKNGLACLQNLNDLPEKIVIRPLPGLPVVKDLVVDMNQFYDQYDKIQPFL
INNQPAPPKERLQSPEEREHLNGLYECILCACCSTSCPSFWWNPDKFLGPSALLNAYRFI
IDSRDTATAERLARLDDPFSLFRCKGIMNCVSVCPKGLNPTKAIGHIRNMLLDQAG
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgagtagaggtactcgtacattcgaaatctaccgctatgatcctgataaggataaagcg
ccgtacatgcaaactttcaagcttgaattgactgataagcaccgtatgttgcttgatgca
ttgcttgctttgaaggttcaagacgaaacgttaacattccgtcgttcttgccgtgaaggt
atttgtggttctgatggtgtgaatatcaatggtaaaaatggtttggcttgcttgcaaaac
cttaacgatttaccagagaaaatcgtaattcgtccattacctggtttgccggttgttaaa
gatttggttgttgatatgaaccaattctatgatcagtatgacaaaattcagccattcttg
atcaataaccaacctgctccacctaaagagcgtttgcaatctcctgaagagcgtgaacac
ttaaatggtttgtatgagtgtattctttgtgcatgttgttcaacttcatgcccatcattc
tggtggaaccctgataaattcttgggtccttcagcgttgttgaatgcatatcgttttatt
atcgactctcgtgatactgcaactgcagaacgtttggctcgtcttgacgatccgttcagt
ttgttccgttgtaaaggtattatgaactgtgtgtcagtatgtcctaaaggtttgaatcca
acaaaagcaatcggtcatatccgtaatatgttgttagatcaagcgggttaa

DBGET integrated database retrieval system