KEGG   Acinetobacter baumannii ATCC 17978: A1S_3449Help
Entry
A1S_3449          CDS       T00486                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
acb  Acinetobacter baumannii ATCC 17978
Pathway
acb00620  Pyruvate metabolism
acb00680  Methane metabolism
acb01100  Metabolic pathways
acb01120  Microbial metabolism in diverse environments
acb01200  Carbon metabolism
Module
acb_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:acb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A1S_3449
  09102 Energy metabolism
   00680 Methane metabolism
    A1S_3449
Enzymes [BR:acb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     A1S_3449
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ABO13838
UniProt: A3MA94
LinkDB All DBs
Position
3960887..3963571
Genome map
AA seq 894 aa AA seqDB search
MVQQIDAPLREDVRLLGNLLGETLKQHAGQELFNQIEQIRALAKGARDGQAEAEKQLEQL
FLELPDEELLPLTRAFSHFLNFANIAEQYHVVRSRRQAEFDPDANSPNPLVHLFKKFKDK
NISTEKLFQQICDLKIELVLTAHPTEVSRRTLIQKYDDINACLSQLDQQKLTPRERQNAL
ANLKQQISSAWQTDEIRQHRPTPVDEAKWGFATIEQTLWNAVPKFIRELNELVQDNCQQN
LPLHIAPVRFASWMGGDRDGNPNVTHQITQEVLWLSRWQAADLYLRDIENLRWELSIQSC
SEEMVQAIGSPHPEPYREYLRATRERLKATRHWLAQRLQGLEADDSNVIKSKDELLQPLL
LCYRSLIDSNLPEIANGQLLDFIYRVNCFGIELLKLDIRQESGRHRQAISAITEYLGLGN
FESWTEQARQNFLIQELQSKRPLLPKYINEPEGSLIGHPDVQEVFATMRTLADQPPESLG
AYIISMAEYPSDVLAVLLLQKEAGIQHPLRVVPLFETLKDLDGAATTMNTLFNMHWYKQH
IQGKHEVMIGYSDSAKDAGFMSANWAQYRAQEELTAIARKHGVQLTLFHGRGGSISRGGA
PTQQALFSQPPGSISGAIRVTEQGEMIRFKFGLEGIAMQNLEIYTAATLEATLLPPPEPK
AEWRELMNRMTDHSVKVYRQTVRENPHFVKYLRTVTPELELQMLPLGSRPAKRKVSGGIE
SLRAIPWVFAWTQIRLMLPAWLGTGAAINEVIADQQKATLDEMLQQWPYFQTLIDMLEMV
LSKADANIALYYESHLTEDEDLKVLGNQLRQRLKDAVETLLTLKDESKLLSDNEVLDQSM
QVRKPYLLPLHLLQAELMKRRRDYLAERQAEHTPVDHALMVSIAGIAAGLRNTG
NT seq 2685 nt NT seq  +upstreamnt  +downstreamnt
atggttcagcaaatcgatgcgccactgcgtgaggatgtccgcttacttggcaatttatta
ggtgaaaccctaaaacagcatgcaggacaagaactgtttaatcagatcgagcaaatccgt
gctcttgccaaaggtgcacgtgatggtcaagctgaagccgaaaagcaattagaacaatta
tttttagaattgcccgatgaagagctattgcctcttacccgcgctttttctcacttcctc
aattttgccaatattgctgagcaatatcatgtggtacgtagccgcagacaggcagagttt
gatccggatgcaaactccccgaatccccttgttcacttatttaaaaagtttaaagataaa
aatatttcgacagaaaaactgttccagcaaatttgtgatcttaagattgaattggtactt
acggcgcatccaacagaagtgagtcgtcgtaccctgattcaaaaatatgacgatatcaat
gcttgtctatcacaacttgatcagcaaaaacttactccgcgtgaacgacaaaatgctctt
gccaatttaaaacaacaaattagttcggcttggcaaacagatgaaatcaggcagcaccgc
ccgaccccggtagatgaagcaaaatggggctttgccacaattgagcaaacgctttggaat
gctgttcctaaatttatccgtgagctaaatgaactggttcaagacaattgccaacaaaac
ttaccacttcatattgctccggtacgttttgcatcttggatgggtggagaccgtgatggt
aacccgaacgttactcatcaaattacccaagaagtattatggttatcacgctggcaagct
gccgacctctatctaagagatatcgaaaacttacgttgggaactatcaattcagtcttgt
tccgaagaaatggttcaagccattggtagtcctcatccagagccttatcgtgagtattta
cgtgcaacacgtgagcgtttaaaagcaactcgtcattggttagctcagcgcctacaaggc
ttagaagctgatgacagcaatgtcattaaaagcaaagatgaactgttacaaccattattg
ctgtgctatcgctctctaattgacagtaatctacctgaaatcgcgaatggtcaactactc
gactttatctaccgtgtgaactgttttggtattgaactgcttaagctcgatattcgccaa
gaatcaggccgtcatcgccaagccatttcagccattactgagtatttaggtttaggtaat
tttgagtcatggactgagcaagcgcgccaaaacttccttattcaggaactccaaagcaaa
cgcccgctactaccgaagtatattaatgagccagaaggtagtttgattggtcacccagat
gtacaagaagtatttgcaaccatgcgtactttggcagaccaaccacctgagtctttaggg
gcttatattatttctatggctgaatatccaagtgatgttttagctgtattgttattgcaa
aaagaagccggtattcagcatcctttacgtgtagtgcctttatttgagactttaaaagac
ttagatggcgcagcaactaccatgaatacgttgtttaatatgcattggtataagcagcac
attcagggtaaacatgaagtcatgatcggctactcggattcagcaaaagatgccggtttc
atgtctgccaactgggctcaataccgtgctcaagaagagctgactgcaattgctcgtaaa
cacggcgtacagttgactctgttccacggtcgtggcggctcaattagccgtggtggtgct
ccaacgcaacaagcactcttttcgcaaccaccgggctcaatctctggtgcaattcgtgtg
acagaacaaggtgaaatgatccgcttcaaattcggtctagaaggtattgccatgcaaaac
cttgaaatctataccgcagcaacgcttgaagcgacattattaccaccaccagagcctaag
gctgagtggcgtgaacttatgaaccgtatgacagatcattctgtgaaggtttatcgtcaa
acagtgcgtgaaaacccgcattttgtgaaatatttacggactgtcactcctgagcttgaa
ttacaaatgttaccgctaggttcacgtccggcaaaacgtaaagtaagtggaggtatcgaa
tctttacgtgccattccatgggtatttgcttggacacaaatccgtttgatgttacctgca
tggttaggtacaggtgcggcgattaatgaagtgattgctgatcagcaaaaagcaacgctt
gatgaaatgcttcagcaatggccttatttccagacacttattgatatgctggaaatggta
ttgtctaaagccgatgccaatattgcactctactacgagtctcatttaactgaagatgaa
gatttaaaagtgcttggcaatcagttacgccaacgtctaaaagatgctgtggaaacctta
cttacgttaaaagatgaatcaaaactattaagcgacaatgaagttttggatcagtctatg
caagttcgtaaaccttatttactgcctttacatcttttacaagctgaactcatgaaacgc
cgccgtgattatcttgctgaacgtcaggcagaacatacccctgttgaccatgcacttatg
gtaagtattgccggaattgctgctggtttacgtaatacaggctaa

DBGET integrated database retrieval system