KEGG   Acinetobacter pittii: BDGL_000385Help
Entry
BDGL_000385       CDS       T01684                                 

Definition
(RefSeq) hypothetical protein
Organism
acc  Acinetobacter pittii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 4HBT 4HBT_3 DUF2840
Motif
Other DBs
NCBI-GeneID: 11638563
NCBI-ProteinID: YP_004994653
UniProt: F0KHM3
LinkDB All DBs
Position
complement(417869..418258)
Genome map
AA seq 129 aa AA seqDB search
MDQKTLEHLPPIHHHLGGHNIYWNDKNTELTIHYTALESFTNPRGTVEGGMICAMLDDVM
GLFAFLANDSKPATTINLTMDFLRPCAVGEVLTKCRFIKQGKTVLNLESEAWQNNKMIAR
STANFLVLD
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atggatcaaaaaactttagaacacttaccccccatccaccatcatttgggtggacacaat
atttattggaatgataagaacactgaactcaccatccactacacggcgctagaaagcttt
accaatccacgcggcaccgttgaaggtggcatgatttgcgccatgcttgatgacgtgatg
ggactttttgcatttcttgcaaatgacagtaaacccgccaccacaattaacttaacgatg
gattttttaagaccctgtgccgttggcgaagtccttacaaaatgtcgattcattaaacaa
ggcaaaaccgtactgaatctcgaaagtgaagcttggcaaaacaacaaaatgattgcacga
agcacagctaattttctggttttagattaa

DBGET integrated database retrieval system