KEGG   Acinetobacter pittii: BDGL_000841Help
Entry
BDGL_000841       CDS       T01684                                 

Gene name
ahpF
Definition
(RefSeq) alkyl hydroperoxide reductase subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
acc  Acinetobacter pittii
Brite
KEGG Orthology (KO) [BR:acc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BDGL_000841 (ahpF)
Enzymes [BR:acc01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BDGL_000841 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored HI0933_like DAO FAD_binding_3 Thi4 AlaDh_PNT_C NAD_binding_8 K_oxygenase Cytochrom_C_2 FMO-like Spermine_synth Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 11639021
NCBI-ProteinID: YP_004995109
UniProt: F0KLL1
LinkDB All DBs
Position
887528..889114
Genome map
AA seq 528 aa AA seqDB search
MHWSKKQMLDQNIKTQLKAYLERLESPIELVAALDESDKAAQIKELVTEIAELSDQVTAR
FDGNNTRRPSFGVAKVGEQPRVFFAGLPMGHEFTSLILALLQVSGYAPKVSDDVLNQIKG
LNLKANFDVFVSLSCHNCPDVVQALNLIAIYNPNTTATMIDGSFFQDEVEQRKIMAVPMV
FQDNEHIGQGRMTLEEIVAKLDTNSAEKDAAALNAKDAFDVLVIGGGPAGATAAIYAARK
GINTGIVAERFGGQVMDTMDIENFTSVQKTQGPKFAAEMEAHVREYDVDIMNLQRVSKIT
GANQTANGLVEVELENGAKLESKTVILSTGARWREMNVPGEQEYRTRGVAYCPHCDGPLF
KGKRVAVIGGGNSGVEAAIDLAGIVEHVTLVEFDTKLRADQVLQNKLHSLPNTTVIMNAL
STEVLGDGSQVTGLKYKDRATDEEHVVELAGIFVQIGLLPNTDFLKDSEVELTNRGEIIV
NDRNETNVQGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYIIRSGQ
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgcattggagtaaaaaacagatgttagatcaaaacattaaaactcaattaaaagcttac
ttagaacgtctagaaagtccaatcgaattagttgctgctttagatgaatcagataaagca
gctcaaattaaagagttagtgacagaaattgctgaactatctgaccaagtcactgcccgt
tttgacggtaataatacacgtcgtccaagctttggtgtggctaaagtaggtgaacagcct
cgtgtgttcttcgcaggcttaccaatgggccatgagtttacatctttgatcttggcactg
ttacaagtgtctggctatgcacctaaagtgtcggatgatgtgctcaaccagattaaaggc
ttaaacctcaaagctaactttgatgtgtttgtatccttaagctgtcataactgtccagat
gtagtacaagcgcttaacctgattgccatttacaacccgaacaccacggcaaccatgatt
gacggttcattcttccaagacgaagttgagcaacgcaaaatcatggccgtaccaatggta
ttccaagacaatgagcacattggtcaaggtcgtatgacccttgaagagattgtggcaaaa
cttgataccaactcagctgaaaaagacgcggcagcactcaatgccaaagatgcatttgat
gtattggtgattggtggtggtcctgcgggcgcaacagctgcgatctatgctgcacgtaaa
ggtattaacaccggtatcgtggcggaacgcttcggtggtcaggtgatggacaccatggac
attgaaaacttcacttctgtgcaaaagactcaaggtcctaagtttgctgccgagatggaa
gcccatgttcgtgaatatgatgtcgatatcatgaacctgcaacgtgtcagcaaaatcaca
ggggcaaaccagactgcaaatggcttggttgaagttgaacttgaaaacggtgcaaaactt
gaatcgaaaactgtgatcctttctacaggtgcacgttggagagagatgaatgtaccgggt
gagcaagaataccgtacccgtggtgttgcgtactgcccacactgtgatggtccattgttc
aaaggcaaacgtgttgctgtgattggtggtggtaactcaggtgttgaggcagcaattgac
cttgcagggattgttgagcatgtaactctggtggaattcgataccaaacttcgtgcagac
caagtgttgcaaaacaaattgcatagcttgccaaacaccactgtgattatgaatgcctta
agtacagaagtgttaggcgacggttcacaagtgactggccttaaatataaagaccgtgcg
actgatgaagagcatgtggtagagcttgcagggatctttgtacagattggtttattgcca
aacactgacttcttgaaagacagtgaagttgagttaaccaaccgtggcgagatcattgtg
aatgaccgcaacgaaaccaatgtgcaaggtgtatttgctgcgggtgactgtacaacagtg
ccttacaagcaaatcattattgctacaggtgaaggcgctaaagcatcactctcagcgttt
gattacatcatccgttctgggcagtaa

DBGET integrated database retrieval system